(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE156

CP000435.PE156       Location/Qualifiers
FT   CDS             171847..172128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0158"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47431"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDS7"
FT                   /protein_id="ABI47431.1"
FT                   /translation="MQSKGRICQDDWKLRFEICLKAILLGLDLGSDHRVNAVFSSWKIL
FT                   RLNEAPGEGLKQKINPSKALGKCEGEVSRSQQIRAANHVKRYAARATP"
     MQSKGRICQD DWKLRFEICL KAILLGLDLG SDHRVNAVFS SWKILRLNEA PGEGLKQKIN        60
     PSKALGKCEG EVSRSQQIRA ANHVKRYAAR ATP                                     93
//

If you have problems or comments...

PBIL Back to PBIL home page