(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE158

CP000435.PE158       Location/Qualifiers
FT   CDS             complement(173210..174649)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0160"
FT                   /product="mannose-1-phosphate
FT                   guanylyltransferase/mannose-6-phosphate isomerase"
FT                   /note="identified by match to protein family HMM PF00483;
FT                   match to protein family HMM PF01050; match to protein
FT                   family HMM PF07883; match to protein family HMM TIGR01479"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47871"
FT                   /db_xref="GOA:Q0IDS5"
FT                   /db_xref="InterPro:IPR001538"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR006375"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDS5"
FT                   /protein_id="ABI47871.1"
FT                   /translation="MITPLIPVILCGGTGTRLWPLSRASYPKQYWPLGGSGDETLLQQT
FT                   QKRLTGIKALGNPLLICNEDHRFIVAEQMRQIDVEPGAILLEPMGRNTAPAVAVAALQA
FT                   TAKGDDPLLLVLAADHVIRDRSHFQAAIAAGRKEAEVGRLVAFGIVPTAPETGYGYIEA
FT                   AEPLVPGALTPVPIARFVEKPDQATAEQFLASGRFTWNSGMFLFKASAMLAELERLTPE
FT                   VVSCCRSALEQDTADLDFLRLDRDAFAKCPNVAIDVAVMEQTELGTVLPLDAGWSDVGS
FT                   WSALWDTADRDENGNVLRGRVISEGSKNCYLRSEHRLVVGLGVENLVVVETDDAVLIAD
FT                   RSQAQNVKTVVKQLEAEGSPEGKAHRKIYRPWGAYTGVVEGTRWQVKRISVKPGASLSL
FT                   QMHHHRAEHWVVVHGTALVERNGETELIGENQSTYIPIGCKHRLSNPGRIPVEMIEVQS
FT                   GEYLGEDDIVRFEDRYGRSDL"
     MITPLIPVIL CGGTGTRLWP LSRASYPKQY WPLGGSGDET LLQQTQKRLT GIKALGNPLL        60
     ICNEDHRFIV AEQMRQIDVE PGAILLEPMG RNTAPAVAVA ALQATAKGDD PLLLVLAADH       120
     VIRDRSHFQA AIAAGRKEAE VGRLVAFGIV PTAPETGYGY IEAAEPLVPG ALTPVPIARF       180
     VEKPDQATAE QFLASGRFTW NSGMFLFKAS AMLAELERLT PEVVSCCRSA LEQDTADLDF       240
     LRLDRDAFAK CPNVAIDVAV MEQTELGTVL PLDAGWSDVG SWSALWDTAD RDENGNVLRG       300
     RVISEGSKNC YLRSEHRLVV GLGVENLVVV ETDDAVLIAD RSQAQNVKTV VKQLEAEGSP       360
     EGKAHRKIYR PWGAYTGVVE GTRWQVKRIS VKPGASLSLQ MHHHRAEHWV VVHGTALVER       420
     NGETELIGEN QSTYIPIGCK HRLSNPGRIP VEMIEVQSGE YLGEDDIVRF EDRYGRSDL        479
//

If you have problems or comments...

PBIL Back to PBIL home page