(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE162

CP000435.PE162       Location/Qualifiers
FT   CDS             176414..176560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0164"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47282"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDS1"
FT                   /protein_id="ABI47282.1"
FT                   /translation="MRSNDLAADIRWQQRFVNYKRALEQLERFFEPPALNEREQQGLIK
FT                   AFE"
     MRSNDLAADI RWQQRFVNYK RALEQLERFF EPPALNEREQ QGLIKAFE                     48
//

If you have problems or comments...

PBIL Back to PBIL home page