(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE164

CP000435.PE164       Location/Qualifiers
FT   CDS             176842..177183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0166"
FT                   /product="nucleotidyltransferase domain protein"
FT                   /note="identified by match to protein family HMM PF01909"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45659"
FT                   /db_xref="GOA:Q0IDR9"
FT                   /db_xref="InterPro:IPR041633"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDR9"
FT                   /protein_id="ABI45659.1"
FT                   /translation="MDATSSEKAQTVVIPGISGPQQQRLLDVLIKQADVDAMWLFGSRA
FT                   MGQERPGSDIDLCVDAARLTHLERLRLMADIDELLLPWTVDLALRHELPPDLVSHVERV
FT                   GRCLWTRTK"
     MDATSSEKAQ TVVIPGISGP QQQRLLDVLI KQADVDAMWL FGSRAMGQER PGSDIDLCVD        60
     AARLTHLERL RLMADIDELL LPWTVDLALR HELPPDLVSH VERVGRCLWT RTK              113
//

If you have problems or comments...

PBIL Back to PBIL home page