(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE166

CP000435.PE166       Location/Qualifiers
FT   CDS             177551..177757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0168"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46680"
FT                   /db_xref="InterPro:IPR035069"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDR7"
FT                   /protein_id="ABI46680.1"
FT                   /translation="MTSVYIAKSFNYWRESDGQFLGYLNAYPDHWTQGEDLEDLKVKLL
FT                   DLYHEFFKQDLPGIRKVGELVVA"
     MTSVYIAKSF NYWRESDGQF LGYLNAYPDH WTQGEDLEDL KVKLLDLYHE FFKQDLPGIR        60
     KVGELVVA                                                                 68
//

If you have problems or comments...

PBIL Back to PBIL home page