(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE17

CP000435.PE17        Location/Qualifiers
FT   CDS             19383..20696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0017"
FT                   /product="conserved hypothetical protein TIGR00275"
FT                   /note="identified by match to protein family HMM PF00890;
FT                   match to protein family HMM PF03486; match to protein
FT                   family HMM TIGR00275"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46168"
FT                   /db_xref="InterPro:IPR004792"
FT                   /db_xref="InterPro:IPR023166"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IE66"
FT                   /protein_id="ABI46168.1"
FT                   /translation="MTVPDRRVSATATTESPCVSNPRHDLIVIGGGPAGFMAAITAAER
FT                   GVRDVLILEATPEVLTKVRISGGGRCNVTHACWDPMELVGHYPRGSKPLRGPFSQFACG
FT                   DSIAWFDEHGLTLVEESDGRMFPQQNRSEAVVECLRRAALAAGVKIQCGSAVRELSCSA
FT                   GGDFQLCDQRSALHHTKRVLLATGGHPSGRRLAQDLGHRIVPPVPSLFSLKLQAPALTA
FT                   CSGIALDDVSLDLKVGDQRFREKGRVLITHRGVSGPAILRLTAFAARALHASRYKGELR
FT                   VDWSGGLGRERVQQRLQQARREQARRTLVAAKPFENLPRRLWLAFLTQAGVAGERRWAD
FT                   LPVKAERNLVETLCAQRLSVQGRGPFGEEFVTAGGVDLGEVNLATMESRRCTGLYLAGE
FT                   LLDVDGVTGGFNFQACWSGGWLAGKAIAAALAPVDGPT"
     MTVPDRRVSA TATTESPCVS NPRHDLIVIG GGPAGFMAAI TAAERGVRDV LILEATPEVL        60
     TKVRISGGGR CNVTHACWDP MELVGHYPRG SKPLRGPFSQ FACGDSIAWF DEHGLTLVEE       120
     SDGRMFPQQN RSEAVVECLR RAALAAGVKI QCGSAVRELS CSAGGDFQLC DQRSALHHTK       180
     RVLLATGGHP SGRRLAQDLG HRIVPPVPSL FSLKLQAPAL TACSGIALDD VSLDLKVGDQ       240
     RFREKGRVLI THRGVSGPAI LRLTAFAARA LHASRYKGEL RVDWSGGLGR ERVQQRLQQA       300
     RREQARRTLV AAKPFENLPR RLWLAFLTQA GVAGERRWAD LPVKAERNLV ETLCAQRLSV       360
     QGRGPFGEEF VTAGGVDLGE VNLATMESRR CTGLYLAGEL LDVDGVTGGF NFQACWSGGW       420
     LAGKAIAAAL APVDGPT                                                      437
//

If you have problems or comments...

PBIL Back to PBIL home page