(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE172

CP000435.PE172       Location/Qualifiers
FT   CDS             complement(183185..184228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0174"
FT                   /product="N-acetylneuraminic acid condensing enzyme"
FT                   /EC_number="4.1.3.-"
FT                   /note="identified by match to protein family HMM PF01354;
FT                   match to protein family HMM PF03102"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46784"
FT                   /db_xref="GOA:Q0IDR1"
FT                   /db_xref="InterPro:IPR006190"
FT                   /db_xref="InterPro:IPR013132"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="InterPro:IPR036732"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDR1"
FT                   /protein_id="ABI46784.1"
FT                   /translation="MPPSILFNSRRISSIDPTYIVAEIGVNHNGNISLAHKLIDSAKDA
FT                   GADAVKFQTYVTDELVIRNTRTAKYQKENALFDDQYTMLEKYELSFESFHELYRHCAAA
FT                   GIDFLSTPFDPVSLRFIANLKPVAIKWASGELTNKMLLDQAAKTRLPIILSTGMSRIND
FT                   VDDAITWIGRNTPLVVLQCVSNYPAAMSDQNLRVLPFLENRYQCPVGFSDHTQGFQCAI
FT                   AAKGLGMSVLEKHFTLDRNLDGPDHKASVDFTGLKELVSEVRSIEVALGNGVKLPAPSE
FT                   LDAKTVARKSLFYARSLKAGHIITKNDLAAKRPSFGIPPSEYEAFLGKQLKIDSVKDVA
FT                   LSYEDFE"
     MPPSILFNSR RISSIDPTYI VAEIGVNHNG NISLAHKLID SAKDAGADAV KFQTYVTDEL        60
     VIRNTRTAKY QKENALFDDQ YTMLEKYELS FESFHELYRH CAAAGIDFLS TPFDPVSLRF       120
     IANLKPVAIK WASGELTNKM LLDQAAKTRL PIILSTGMSR INDVDDAITW IGRNTPLVVL       180
     QCVSNYPAAM SDQNLRVLPF LENRYQCPVG FSDHTQGFQC AIAAKGLGMS VLEKHFTLDR       240
     NLDGPDHKAS VDFTGLKELV SEVRSIEVAL GNGVKLPAPS ELDAKTVARK SLFYARSLKA       300
     GHIITKNDLA AKRPSFGIPP SEYEAFLGKQ LKIDSVKDVA LSYEDFE                     347
//

If you have problems or comments...

PBIL Back to PBIL home page