(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE178

CP000435.PE178       Location/Qualifiers
FT   CDS             complement(190550..191539)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0180"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47679"
FT                   /db_xref="GOA:Q0IDQ5"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDQ5"
FT                   /protein_id="ABI47679.1"
FT                   /translation="MIALAFINATRIRSGYFDLNEINLQDGAFIQIKQTFEFIQSGGAV
FT                   TRALENPIFVTHLVRVAIFIPFSYLGSLGHGQGLEYVLLILISLPVVMRYYKRSNDIIY
FT                   LAPLVLPFLISYRSFLAALAIGYVVIAITSKGNILFLLFGVTLSLLSTAVMVQSSLLIL
FT                   IYRKKISCLLRNNPVAIVPLIAFLGITLLVTLVKIQGFVGGLDGYTSEYGSDGIQSAIT
FT                   RSTLVIGLAKGSLRGYLSLAIALLLIISLVRLGNSRNKELKTYFRILSCLAPGLLFEGL
FT                   GIVSILFPILWMVRGVHLIELGEFNRGYIRKSVKSCKATYTRDDCTSV"
     MIALAFINAT RIRSGYFDLN EINLQDGAFI QIKQTFEFIQ SGGAVTRALE NPIFVTHLVR        60
     VAIFIPFSYL GSLGHGQGLE YVLLILISLP VVMRYYKRSN DIIYLAPLVL PFLISYRSFL       120
     AALAIGYVVI AITSKGNILF LLFGVTLSLL STAVMVQSSL LILIYRKKIS CLLRNNPVAI       180
     VPLIAFLGIT LLVTLVKIQG FVGGLDGYTS EYGSDGIQSA ITRSTLVIGL AKGSLRGYLS       240
     LAIALLLIIS LVRLGNSRNK ELKTYFRILS CLAPGLLFEG LGIVSILFPI LWMVRGVHLI       300
     ELGEFNRGYI RKSVKSCKAT YTRDDCTSV                                         329
//

If you have problems or comments...

PBIL Back to PBIL home page