(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE18

CP000435.PE18        Location/Qualifiers
FT   CDS             complement(20744..24079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0018"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47561"
FT                   /db_xref="InterPro:IPR011121"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IE65"
FT                   /protein_id="ABI47561.1"
FT                   /translation="MSLKSFFMSDTQAPQLLGVTLDTTTLDPSTPGGAFLSGAITFSDD
FT                   LSGLSNIYITYTEVNSGQEIQLSFNLSEFGGNALTGNALNGTITSSRQLDRFAASGDYI
FT                   ISSIQVDDQAGNGEFYSRFEDNWDTQLDALNIAEAARSFTVANSSADTQAPQLIDVTLD
FT                   TTTLDPSAPGGAFLSGAITFSDDLSGLSNIFITYTEVNSGQEIQLSFKLSEFGGDALTG
FT                   NARNGTITSSSQLDRFAASGDYIISSIQVDDQAGNGEFYSRFEDNWDTQLDALNIAEAA
FT                   RSFTVANSSADTQAPQLIDVTLDTTTLDPSAPGGAFLSGAITFSDDLSGLSNIFITYTE
FT                   VNSGQEIQLSFKLSEFGGDALTGNARNGTITSSSQLDRFAASGDYIISSIQVDDQAGNG
FT                   EFYSRFEDNWDTQLDALNIAEAARSFTVANSSAEPQTGEDSSAPTITGLNLSATTIDPS
FT                   QPGGAFLTADVSFTDDASGIDFLFLSFESVDSNQEITFSLLPSDSLEGNLLEGSIGTSE
FT                   FIDPFAANGEYVLRQIEGSDKAGNQFVFRDNSELPVDNSDWEQFLSDSNIQQTSFEINN
FT                   SQSDITAPTITGLNLSATTIDPSQPGGAFLTADVSFTDDASGIDFLFLSFESVDSNQEI
FT                   TFSLLPSDSLEGNLLEGSIGTSEFIDPFAANGEYVLRQIEGSDKAGNQFVFRDNSELPG
FT                   DNSDWEQFLSDSNIQQTSFEINNSQSDITAPTITGLNLSATTIDPSQPGGAFLTADVSF
FT                   TDDASGIDFLFLSFESVDSNQEITFSLLPSDSLEGNLLEGSIGTSEFIDPFAANGEYVL
FT                   RQIEGSDKAGNQFVFRDNSELPVDNSDWEQFLSDSNIQQTSFEIKRSDSDNGAVDADNN
FT                   GLVDNTPVYTLFNDGDPLTITKERSDGSTRTFSATGIPNWDATQAVNTEDNSGNFYVLL
FT                   EGADGSTREDQFKVWTTDISGSIASSTGWRSAEQLVQAGWEERFNIDFDGDELIGIPTA
FT                   DEDQNGLVDNTSVYTLFNDGDPLTISKQRANGSTRNFSATGIPNWDVTQAVNAEDNSGN
FT                   FYLLLEGADGTTREDQYKVWTTDKTASFLSGTGWRSAEQLSDAWGEFFSILNSTDSTTT
FT                   SISV"
     MSLKSFFMSD TQAPQLLGVT LDTTTLDPST PGGAFLSGAI TFSDDLSGLS NIYITYTEVN        60
     SGQEIQLSFN LSEFGGNALT GNALNGTITS SRQLDRFAAS GDYIISSIQV DDQAGNGEFY       120
     SRFEDNWDTQ LDALNIAEAA RSFTVANSSA DTQAPQLIDV TLDTTTLDPS APGGAFLSGA       180
     ITFSDDLSGL SNIFITYTEV NSGQEIQLSF KLSEFGGDAL TGNARNGTIT SSSQLDRFAA       240
     SGDYIISSIQ VDDQAGNGEF YSRFEDNWDT QLDALNIAEA ARSFTVANSS ADTQAPQLID       300
     VTLDTTTLDP SAPGGAFLSG AITFSDDLSG LSNIFITYTE VNSGQEIQLS FKLSEFGGDA       360
     LTGNARNGTI TSSSQLDRFA ASGDYIISSI QVDDQAGNGE FYSRFEDNWD TQLDALNIAE       420
     AARSFTVANS SAEPQTGEDS SAPTITGLNL SATTIDPSQP GGAFLTADVS FTDDASGIDF       480
     LFLSFESVDS NQEITFSLLP SDSLEGNLLE GSIGTSEFID PFAANGEYVL RQIEGSDKAG       540
     NQFVFRDNSE LPVDNSDWEQ FLSDSNIQQT SFEINNSQSD ITAPTITGLN LSATTIDPSQ       600
     PGGAFLTADV SFTDDASGID FLFLSFESVD SNQEITFSLL PSDSLEGNLL EGSIGTSEFI       660
     DPFAANGEYV LRQIEGSDKA GNQFVFRDNS ELPGDNSDWE QFLSDSNIQQ TSFEINNSQS       720
     DITAPTITGL NLSATTIDPS QPGGAFLTAD VSFTDDASGI DFLFLSFESV DSNQEITFSL       780
     LPSDSLEGNL LEGSIGTSEF IDPFAANGEY VLRQIEGSDK AGNQFVFRDN SELPVDNSDW       840
     EQFLSDSNIQ QTSFEIKRSD SDNGAVDADN NGLVDNTPVY TLFNDGDPLT ITKERSDGST       900
     RTFSATGIPN WDATQAVNTE DNSGNFYVLL EGADGSTRED QFKVWTTDIS GSIASSTGWR       960
     SAEQLVQAGW EERFNIDFDG DELIGIPTAD EDQNGLVDNT SVYTLFNDGD PLTISKQRAN      1020
     GSTRNFSATG IPNWDVTQAV NAEDNSGNFY LLLEGADGTT REDQYKVWTT DKTASFLSGT      1080
     GWRSAEQLSD AWGEFFSILN STDSTTTSIS V                                     1111
//

If you have problems or comments...

PBIL Back to PBIL home page