(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE186

CP000435.PE186       Location/Qualifiers
FT   CDS             200038..200346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0188"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45364"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDP7"
FT                   /protein_id="ABI45364.1"
FT                   /translation="MSACPVLFSRVLDLKSKLRAGFQHCSASQLTPVCRNLKPFSSLHS
FT                   FVSLPFAVLLFSALGSGLDLWIPIPQLHCQLLDQPNARCCCCPPPPPPAEVRWTFRT"
     MSACPVLFSR VLDLKSKLRA GFQHCSASQL TPVCRNLKPF SSLHSFVSLP FAVLLFSALG        60
     SGLDLWIPIP QLHCQLLDQP NARCCCCPPP PPPAEVRWTF RT                          102
//

If you have problems or comments...

PBIL Back to PBIL home page