(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE190

CP000435.PE190       Location/Qualifiers
FT   CDS             201032..202978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0192"
FT                   /product="Putative nucleotide sugar epimerase/dehydratase"
FT                   /note="identified by match to protein family HMM PF00106;
FT                   match to protein family HMM PF01370; match to protein
FT                   family HMM PF02719; match to protein family HMM PF04321;
FT                   match to protein family HMM PF07993"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46597"
FT                   /db_xref="GOA:Q0IDP3"
FT                   /db_xref="InterPro:IPR003869"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDP3"
FT                   /protein_id="ABI46597.1"
FT                   /translation="MKFAELSRIYPVPVVNQVVRFPPRARRFLLMGIDALLLPLAVWLS
FT                   FWLRLAHPFHPVFMAAGSWLLMAVLLVGLPLYAFTGQYKGLTRYVGSADLYRLAGRNGL
FT                   LVLLLAGLGLMLGLPMPPRSSWILLWLLLTGFTGAVRFALRDLLLNLRSIHHKQQLRVA
FT                   IYGAGAAGAQLAAALRLAGNHRIITFLDDNPNYWSRSINGVGIQPPQVLKDLEDSVDQV
FT                   LLAIPSLPRSERRRIVDDLQRRGIGVLQVPSVDDLTSGHARIDALRPIAIEDLLGRDEV
FT                   PADPHLLGPGIRDAVVCVTGAGGSIGSELCRQILALSPARLVLLESSEPALYAIEQELC
FT                   SLVPGRTELKAVLGSATDTQLHRLFEDQSVELVFHAAAYKHVPLVEANPLAGLSNNVGS
FT                   TVQVCRAAMAVGVHQVVLISTDKAVRPTNVMGSSKRLAELVVQAHATEGSSTRFSMVRF
FT                   GNVLGSSGSVVPLFRRQIAAGGPITLTHPEIIRYFMTIPEAATLVLQSSVLAQGGDVFL
FT                   LDMGEPVRIKALAEQMVRLSGLSLRDAGHPDGDIEIICTGLRPGEKLYEELLIDAESQP
FT                   TAHPLIYRAEERSIPPHVLWPQLDALEAAIAAQDVEGALALLAQLVPEWQRGDGVNGAG
FT                   AAVAAAVENDLLA"
     MKFAELSRIY PVPVVNQVVR FPPRARRFLL MGIDALLLPL AVWLSFWLRL AHPFHPVFMA        60
     AGSWLLMAVL LVGLPLYAFT GQYKGLTRYV GSADLYRLAG RNGLLVLLLA GLGLMLGLPM       120
     PPRSSWILLW LLLTGFTGAV RFALRDLLLN LRSIHHKQQL RVAIYGAGAA GAQLAAALRL       180
     AGNHRIITFL DDNPNYWSRS INGVGIQPPQ VLKDLEDSVD QVLLAIPSLP RSERRRIVDD       240
     LQRRGIGVLQ VPSVDDLTSG HARIDALRPI AIEDLLGRDE VPADPHLLGP GIRDAVVCVT       300
     GAGGSIGSEL CRQILALSPA RLVLLESSEP ALYAIEQELC SLVPGRTELK AVLGSATDTQ       360
     LHRLFEDQSV ELVFHAAAYK HVPLVEANPL AGLSNNVGST VQVCRAAMAV GVHQVVLIST       420
     DKAVRPTNVM GSSKRLAELV VQAHATEGSS TRFSMVRFGN VLGSSGSVVP LFRRQIAAGG       480
     PITLTHPEII RYFMTIPEAA TLVLQSSVLA QGGDVFLLDM GEPVRIKALA EQMVRLSGLS       540
     LRDAGHPDGD IEIICTGLRP GEKLYEELLI DAESQPTAHP LIYRAEERSI PPHVLWPQLD       600
     ALEAAIAAQD VEGALALLAQ LVPEWQRGDG VNGAGAAVAA AVENDLLA                    648
//

If you have problems or comments...

PBIL Back to PBIL home page