(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE195

CP000435.PE195       Location/Qualifiers
FT   CDS             205611..206435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0197"
FT                   /product="cation transporter, voltage-gated ion channel
FT                   (VIC) family protein"
FT                   /note="identified by match to protein family HMM PF00520;
FT                   match to protein family HMM PF07885"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46223"
FT                   /db_xref="GOA:Q0IDN8"
FT                   /db_xref="InterPro:IPR005821"
FT                   /db_xref="InterPro:IPR028325"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDN8"
FT                   /protein_id="ABI46223.1"
FT                   /translation="MPPDAMNLRLRFRRVVLDADTRAGRIYNLVIFGTILASVAGLLVE
FT                   PTPTWIAASDQAPDWTNVLERICLGVFIADFLLHLWVTPKPSNYLFSFYGLIDFSAVLF
FT                   FFIPQISSGLILWIFKFGRVLRVFKLLRFLDEAQLLGNALKASARRIGVFLFFVVMAQV
FT                   VLGYLMVLVESSHPQTQFQTVGQGVYWAIVTMTTVGYGDIVPQTVLGQLLAAGVMLLGF
FT                   GIIAIPTGIITVETMEQVRRGGRSCTSCGASAHHKKALRCDQCGSILPPLSA"
     MPPDAMNLRL RFRRVVLDAD TRAGRIYNLV IFGTILASVA GLLVEPTPTW IAASDQAPDW        60
     TNVLERICLG VFIADFLLHL WVTPKPSNYL FSFYGLIDFS AVLFFFIPQI SSGLILWIFK       120
     FGRVLRVFKL LRFLDEAQLL GNALKASARR IGVFLFFVVM AQVVLGYLMV LVESSHPQTQ       180
     FQTVGQGVYW AIVTMTTVGY GDIVPQTVLG QLLAAGVMLL GFGIIAIPTG IITVETMEQV       240
     RRGGRSCTSC GASAHHKKAL RCDQCGSILP PLSA                                   274
//

If you have problems or comments...

PBIL Back to PBIL home page