(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE196

CP000435.PE196       Location/Qualifiers
FT   CDS             complement(206467..206841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0198"
FT                   /product="PIN domain, putative"
FT                   /note="identified by match to protein family HMM PF01850"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46877"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR041705"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDN7"
FT                   /protein_id="ABI46877.1"
FT                   /translation="MRCLLDTQVMLWWLLDDPRLRAKSRELLASKPCLVSVASIWEVAI
FT                   KHRIGKLEVSPVVFRDQSIAAGADLLPVLDPHVIETAQLPLLHQDPFDRLLIAQARVEG
FT                   LMAVSSDGQWSGYDVSLHRL"
     MRCLLDTQVM LWWLLDDPRL RAKSRELLAS KPCLVSVASI WEVAIKHRIG KLEVSPVVFR        60
     DQSIAAGADL LPVLDPHVIE TAQLPLLHQD PFDRLLIAQA RVEGLMAVSS DGQWSGYDVS       120
     LHRL                                                                    124
//

If you have problems or comments...

PBIL Back to PBIL home page