(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE2

CP000435.PE2         Location/Qualifiers
FT   CDS             1348..2148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0002"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45445"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IE81"
FT                   /protein_id="ABI45445.1"
FT                   /translation="MTVPDQLLLSDLLHHRVRCDLGLDHGPGVMAWMHPPVHRLLGWVS
FT                   RPSALRTSRDVWRLDQCRGFDDQQVFVKGAPAEADQITLDRLPTLLDADLLNADGERVG
FT                   IIADLAFLPASGQISHYLVARSDPRLPGTSRWRLLPDRIVDQQPGLVSSAIHELDDLPL
FT                   ARASVRQDFLQRSRHWREQLQQFGDRAGERLEGWLEEPPWDEPPAVSDVASSYSSTAAP
FT                   TVDPLDDWDDGDWTDAPRVERGRSVRNDPTDRNDWPDHEEDPWV"
     MTVPDQLLLS DLLHHRVRCD LGLDHGPGVM AWMHPPVHRL LGWVSRPSAL RTSRDVWRLD        60
     QCRGFDDQQV FVKGAPAEAD QITLDRLPTL LDADLLNADG ERVGIIADLA FLPASGQISH       120
     YLVARSDPRL PGTSRWRLLP DRIVDQQPGL VSSAIHELDD LPLARASVRQ DFLQRSRHWR       180
     EQLQQFGDRA GERLEGWLEE PPWDEPPAVS DVASSYSSTA APTVDPLDDW DDGDWTDAPR       240
     VERGRSVRND PTDRNDWPDH EEDPWV                                            266
//

If you have problems or comments...

PBIL Back to PBIL home page