(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE202

CP000435.PE202       Location/Qualifiers
FT   CDS             complement(209895..212570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0205"
FT                   /product="phosphorylase"
FT                   /EC_number="2.4.1.1"
FT                   /note="identified by match to protein family HMM PF00343;
FT                   match to protein family HMM TIGR02093"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46130"
FT                   /db_xref="GOA:Q0IDN1"
FT                   /db_xref="InterPro:IPR000811"
FT                   /db_xref="InterPro:IPR011833"
FT                   /db_xref="InterPro:IPR035090"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDN1"
FT                   /protein_id="ABI46130.1"
FT                   /translation="MATKGEAPHASFCLTVEAEASVTVRPPFQAFFVQYHHTERKTKSN
FT                   RHIPPSMSSSEPLDLRLPTPGCYADPERAGFDADAVFDGMTEHLFFTLGKLAPSASRHD
FT                   LYMALSYAVRDRLMTRYLASLEAIRARPQKTVAYLSAEFLIGPQLANNLLNLGIQNEAE
FT                   EAVKRFGIESLQQIIEVEEEPGLGNGGLGRLAACYMESLASLQIPATGYGIRYEFGIFD
FT                   QLIRDGWQVEVTDKWLKGGWPWELPQPDQACFVGFGGRTESYLDDKGNYRSRWIPSDHA
FT                   IGVPHDVPVLGYRVNTCDRLRLWRADATESFDFYAFNIGDYYGAVEEKVGSETLSKVLY
FT                   PNDGTDEGRRLRLKQQHFFVSCSLQDMLRSLDNRGLSIDDFPEFWTVQLNDTHPAIAVA
FT                   ELMRLLIDDRHMEWDKAWDITRRSVAYTNHTLLPEALEKWDLNLFGSLLPRHLELIYEI
FT                   NRRFLQQVRLRYPGNEAIQRKLSIIDEEGGKSIRMAHLATIGAHHVNGVAALHSDLVRE
FT                   QLMPEFAELWPEKFTNVTNGVTPRRWVALSNPGLSSLLDEHVGPDWVTNMEILRKLEDR
FT                   QNDTGFLNHWEDTKLCVKRKLSTYIHRNTGVLVDPSSLFDVQVKRIHEYKRQHLNALQV
FT                   ITQYLRIKNGQADGLAPRTVIFGGKAAPGYYMAKLIIRFINGIAETINADPDMDGRLRV
FT                   VFLADYNVKLGEQVYPASDLSEQISTAGKEASGTGNMKFAMNGALTIGTLDGANVEIRE
FT                   HVGAENFFLFGKTVEEISALKQSGYRPWEVVESVPELAEAIRLVEMGHFSNGDGELFRP
FT                   LIDNLTGNDPFFVMADFADYLRAQDAVSLAWTDRQHWNRMSVLNSARSGFFSSDRSIRD
FT                   YCRDIWKVEAMPVEITCDVR"
     MATKGEAPHA SFCLTVEAEA SVTVRPPFQA FFVQYHHTER KTKSNRHIPP SMSSSEPLDL        60
     RLPTPGCYAD PERAGFDADA VFDGMTEHLF FTLGKLAPSA SRHDLYMALS YAVRDRLMTR       120
     YLASLEAIRA RPQKTVAYLS AEFLIGPQLA NNLLNLGIQN EAEEAVKRFG IESLQQIIEV       180
     EEEPGLGNGG LGRLAACYME SLASLQIPAT GYGIRYEFGI FDQLIRDGWQ VEVTDKWLKG       240
     GWPWELPQPD QACFVGFGGR TESYLDDKGN YRSRWIPSDH AIGVPHDVPV LGYRVNTCDR       300
     LRLWRADATE SFDFYAFNIG DYYGAVEEKV GSETLSKVLY PNDGTDEGRR LRLKQQHFFV       360
     SCSLQDMLRS LDNRGLSIDD FPEFWTVQLN DTHPAIAVAE LMRLLIDDRH MEWDKAWDIT       420
     RRSVAYTNHT LLPEALEKWD LNLFGSLLPR HLELIYEINR RFLQQVRLRY PGNEAIQRKL       480
     SIIDEEGGKS IRMAHLATIG AHHVNGVAAL HSDLVREQLM PEFAELWPEK FTNVTNGVTP       540
     RRWVALSNPG LSSLLDEHVG PDWVTNMEIL RKLEDRQNDT GFLNHWEDTK LCVKRKLSTY       600
     IHRNTGVLVD PSSLFDVQVK RIHEYKRQHL NALQVITQYL RIKNGQADGL APRTVIFGGK       660
     AAPGYYMAKL IIRFINGIAE TINADPDMDG RLRVVFLADY NVKLGEQVYP ASDLSEQIST       720
     AGKEASGTGN MKFAMNGALT IGTLDGANVE IREHVGAENF FLFGKTVEEI SALKQSGYRP       780
     WEVVESVPEL AEAIRLVEMG HFSNGDGELF RPLIDNLTGN DPFFVMADFA DYLRAQDAVS       840
     LAWTDRQHWN RMSVLNSARS GFFSSDRSIR DYCRDIWKVE AMPVEITCDV R                891
//

If you have problems or comments...

PBIL Back to PBIL home page