(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE205

CP000435.PE205       Location/Qualifiers
FT   CDS             214425..215348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0208"
FT                   /product="hydrolase, alpha/beta fold family protein"
FT                   /note="identified by match to protein family HMM PF00561"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47594"
FT                   /db_xref="GOA:Q0IDM8"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDM8"
FT                   /protein_id="ABI47594.1"
FT                   /translation="MVSEPWWRFENHAVHGLCQMPEQPEAAAQAQARPAVLLVHGFGAS
FT                   TDHWRHNIPVLASQYEVHALDLLGFGRSAKPAGLTYGGALWRDQLVAYVQQRIGRPTVI
FT                   AGNSLGGFAALAAGAALKEQSAGVVLLNAAGPFSDEQRSKPSGWGAIARRTIASALLKS
FT                   PVLQRVLFENLRRPATIRRTLNQVYVDRTNVDDALVESIRLPSLDPGAFGVFRTVFDIP
FT                   SGQPLDELFDQLQSPLFLLWGIRDPWINAAGRRASFQRHAPENTHEVVLEAGHCPHDEV
FT                   PDQVNKALLDWLGSLQSQPTNTLQLD"
     MVSEPWWRFE NHAVHGLCQM PEQPEAAAQA QARPAVLLVH GFGASTDHWR HNIPVLASQY        60
     EVHALDLLGF GRSAKPAGLT YGGALWRDQL VAYVQQRIGR PTVIAGNSLG GFAALAAGAA       120
     LKEQSAGVVL LNAAGPFSDE QRSKPSGWGA IARRTIASAL LKSPVLQRVL FENLRRPATI       180
     RRTLNQVYVD RTNVDDALVE SIRLPSLDPG AFGVFRTVFD IPSGQPLDEL FDQLQSPLFL       240
     LWGIRDPWIN AAGRRASFQR HAPENTHEVV LEAGHCPHDE VPDQVNKALL DWLGSLQSQP       300
     TNTLQLD                                                                 307
//

If you have problems or comments...

PBIL Back to PBIL home page