(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE207

CP000435.PE207       Location/Qualifiers
FT   CDS             complement(216241..217458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0210"
FT                   /product="glycolate oxidase chain"
FT                   /EC_number="1.1.3.15"
FT                   /note="identified by match to protein family HMM PF01565"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45833"
FT                   /db_xref="GOA:Q0IDM6"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDM6"
FT                   /protein_id="ABI45833.1"
FT                   /translation="MSSTAVLAPNSVEELGQLIADLHAEGRPWVPSGMGSRLHWGPPLA
FT                   ADSGPVVSMRHLSRIVDHAVDDLTITVDAGMPLADLQTALAEHQQWLPLNWPWGSNMAS
FT                   PQSAGSIGGLVARGLSGGLRQRHLGVRDQIIGISLIRSDGVSARAGGRVVKNVAGYDLM
FT                   RLLCGSWGSLALITGLTLRVQPIREPRGQLVLEGELNQLEAFRAEVVGSSFTPERIDWE
FT                   LRPDQGPRILLGVASISDGAVVDQLNRLETIAAKQGVSSERMLWENLIPEGSATSEDPP
FT                   WLLRLCLPPAELQHLFSSRECTALTGWHWQLAAGAGSGEAWQHSGAPTPEYLIEALRRR
FT                   VIALGGQLSVLIQPGAQPGALPAWLDAPSRPLIEAVKRQFDPKQQLSRGRLPGVAAPLN
FT                   SAHSGN"
     MSSTAVLAPN SVEELGQLIA DLHAEGRPWV PSGMGSRLHW GPPLAADSGP VVSMRHLSRI        60
     VDHAVDDLTI TVDAGMPLAD LQTALAEHQQ WLPLNWPWGS NMASPQSAGS IGGLVARGLS       120
     GGLRQRHLGV RDQIIGISLI RSDGVSARAG GRVVKNVAGY DLMRLLCGSW GSLALITGLT       180
     LRVQPIREPR GQLVLEGELN QLEAFRAEVV GSSFTPERID WELRPDQGPR ILLGVASISD       240
     GAVVDQLNRL ETIAAKQGVS SERMLWENLI PEGSATSEDP PWLLRLCLPP AELQHLFSSR       300
     ECTALTGWHW QLAAGAGSGE AWQHSGAPTP EYLIEALRRR VIALGGQLSV LIQPGAQPGA       360
     LPAWLDAPSR PLIEAVKRQF DPKQQLSRGR LPGVAAPLNS AHSGN                       405
//

If you have problems or comments...

PBIL Back to PBIL home page