(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE209

CP000435.PE209       Location/Qualifiers
FT   CDS             complement(218912..219451)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0212"
FT                   /product="glyoxalase family protein family"
FT                   /note="identified by match to protein family HMM PF00903"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46659"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDM4"
FT                   /protein_id="ABI46659.1"
FT                   /translation="MNSFLASSRPSHFGLYVHDLELMEDFYVKKLGFCITDSWEFQGSR
FT                   MLFLSKDPKEHHQIVLATGRQMETPSQFNQISFEVSSLQDLHENYSAIQAIAPGDVVAM
FT                   NHGGSWSVYFSDPESNPIEFFAYTQTYAPPIATIPMDMEQPFETLMAETDALVHQFPES
FT                   ESWQQWRDRFSKTMAG"
     MNSFLASSRP SHFGLYVHDL ELMEDFYVKK LGFCITDSWE FQGSRMLFLS KDPKEHHQIV        60
     LATGRQMETP SQFNQISFEV SSLQDLHENY SAIQAIAPGD VVAMNHGGSW SVYFSDPESN       120
     PIEFFAYTQT YAPPIATIPM DMEQPFETLM AETDALVHQF PESESWQQWR DRFSKTMAG        179
//

If you have problems or comments...

PBIL Back to PBIL home page