(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE213

CP000435.PE213       Location/Qualifiers
FT   CDS             222877..223590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0216"
FT                   /product="Heme oxygenase"
FT                   /EC_number="1.14.99.3"
FT                   /note="identified by match to protein family HMM PF01126"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47778"
FT                   /db_xref="GOA:Q0IDM0"
FT                   /db_xref="InterPro:IPR002051"
FT                   /db_xref="InterPro:IPR016053"
FT                   /db_xref="InterPro:IPR016084"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDM0"
FT                   /protein_id="ABI47778.1"
FT                   /translation="MSVALATQLREGTKKSHTMAENTGFVSCFLKGVVDKLSYRKLVAD
FT                   LFFVYEAMEEEMHRLKEHPVLAPIAFEQLDRVTALEEDLAFYFGTEWRQQIEASPAAKE
FT                   YVARIREVAQTAPELLVGHHYTRYLGDLSGGQILKNIAQKAMNNPTDNGLHFYVFPEIA
FT                   DEKAFKTTYRSALDTLPIDQAMADRIVEEANQAFHLNMKMFQELEGNLVAAIGKVLFGF
FT                   LTRRQRTGSTEAVVA"
     MSVALATQLR EGTKKSHTMA ENTGFVSCFL KGVVDKLSYR KLVADLFFVY EAMEEEMHRL        60
     KEHPVLAPIA FEQLDRVTAL EEDLAFYFGT EWRQQIEASP AAKEYVARIR EVAQTAPELL       120
     VGHHYTRYLG DLSGGQILKN IAQKAMNNPT DNGLHFYVFP EIADEKAFKT TYRSALDTLP       180
     IDQAMADRIV EEANQAFHLN MKMFQELEGN LVAAIGKVLF GFLTRRQRTG STEAVVA          237
//

If you have problems or comments...

PBIL Back to PBIL home page