(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE214

CP000435.PE214       Location/Qualifiers
FT   CDS             223594..224676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0217"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45983"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDL9"
FT                   /protein_id="ABI45983.1"
FT                   /translation="MIQERIQESLPLFTSIRVLVPGTGPRFRCGGLSVALQTARLLSEL
FT                   RPTEVVTYREKEPDHPFLDDLLASALESSGELWLVSWGFDVPMLLKRLRGRSVAYQAHS
FT                   TGYGFDLSPGVPVIAVSRNSLSYWADRAPRNPLYLVPNALEPQWLIRGEWSHNGRRPVD
FT                   VLVQKRKSSPYVLESLVPALRQHGLRVEVQSGWVDDLVNLFNRATVYLYDSADYWRGRG
FT                   VSEGFGLPPLEALSCGCVVFSSFNHALADLLTPGGNAHQIGQGSLVNDLVRIKAAVSDP
FT                   ETWRPQSEELKALLLDLSESRCSERWHKTLSCLDELQRHGAMVESEALRASSSRQLRWH
FT                   QRVNSFRRKVVNRFSDWPFK"
     MIQERIQESL PLFTSIRVLV PGTGPRFRCG GLSVALQTAR LLSELRPTEV VTYREKEPDH        60
     PFLDDLLASA LESSGELWLV SWGFDVPMLL KRLRGRSVAY QAHSTGYGFD LSPGVPVIAV       120
     SRNSLSYWAD RAPRNPLYLV PNALEPQWLI RGEWSHNGRR PVDVLVQKRK SSPYVLESLV       180
     PALRQHGLRV EVQSGWVDDL VNLFNRATVY LYDSADYWRG RGVSEGFGLP PLEALSCGCV       240
     VFSSFNHALA DLLTPGGNAH QIGQGSLVND LVRIKAAVSD PETWRPQSEE LKALLLDLSE       300
     SRCSERWHKT LSCLDELQRH GAMVESEALR ASSSRQLRWH QRVNSFRRKV VNRFSDWPFK       360
//

If you have problems or comments...

PBIL Back to PBIL home page