(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE215

CP000435.PE215       Location/Qualifiers
FT   CDS             224707..224829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0218"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46500"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDL8"
FT                   /protein_id="ABI46500.1"
FT                   /translation="MVNTFDLVAPGWPAEGINADEESDLDAFARAACLLASKTQ"
     MVNTFDLVAP GWPAEGINAD EESDLDAFAR AACLLASKTQ                              40
//

If you have problems or comments...

PBIL Back to PBIL home page