(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE217

CP000435.PE217       Location/Qualifiers
FT   CDS             226619..228835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0220"
FT                   /product="possible glycosyltransferase family 1"
FT                   /note="identified by match to protein family HMM PF00534"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45286"
FT                   /db_xref="GOA:Q0IDL6"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDL6"
FT                   /protein_id="ABI45286.1"
FT                   /translation="MNDVVIIATADWDHPIWTNKQHVARSLADLGNRVLYVESLGIRSV
FT                   QITRSSDWTKIKRRIFRALWPLRQVSPRIWVLSPLVIPGGSDGWSRRLNKLSLRLALAL
FT                   AQAHIGLRQPLLWTFNPLTRRYLNLKMFRSTVYHCVDRIQAQPGMPVELLDLEEKALCQ
FT                   ESQVVFTTAPCLQEGLQALNPATYLFGNVADAEHFAQALEPALPRPVDCPSSERPLVMF
FT                   IGAIDAYKLDMLMLEQLIQATPQWTYLLIGPIAETDSSTEISGLHRLPNVYFIGSRPYR
FT                   DLPAYLACADVALLPLQINDYTRHMYPMKFFEYLAAGCPVVATAIPSLHDQGDVAWLCD
FT                   PSCQSFKQSIQEALEGKGAPRQQRLERASMHTYQRRTEAMLECLDFHGLLLPMTGATTH
FT                   MPNARPLSCQALESLGVSLLVLLIGALRILNQNFLSGALRNAGLKRWSCNTRLLYLAAD
FT                   DAIRSGDMRDARHYMEGLWRENGQVLALHRLLLKPRRGQVVDQLALFETMMNSNVFPLH
FT                   FTGYCAVVLGDWSIEIKDPDLRDGCLNTLTTVITTLLDDPGTYHCLRPVHENRMQLLVS
FT                   AQLSRMRLLMAAQFWLELEACGPSLMRSIADYNPALIDPQSASRLTTNAVRCLAMEGLM
FT                   AWWTNDAQRFLASFSEVHRLVVAADSLSFDSDSLGGQTEAQAFAALMLKQLRGCLWRAD
FT                   LGQQRPGRGQLVGFVLLILNNHLNWKRSDKVQRLLKTLEQTKPA"
     MNDVVIIATA DWDHPIWTNK QHVARSLADL GNRVLYVESL GIRSVQITRS SDWTKIKRRI        60
     FRALWPLRQV SPRIWVLSPL VIPGGSDGWS RRLNKLSLRL ALALAQAHIG LRQPLLWTFN       120
     PLTRRYLNLK MFRSTVYHCV DRIQAQPGMP VELLDLEEKA LCQESQVVFT TAPCLQEGLQ       180
     ALNPATYLFG NVADAEHFAQ ALEPALPRPV DCPSSERPLV MFIGAIDAYK LDMLMLEQLI       240
     QATPQWTYLL IGPIAETDSS TEISGLHRLP NVYFIGSRPY RDLPAYLACA DVALLPLQIN       300
     DYTRHMYPMK FFEYLAAGCP VVATAIPSLH DQGDVAWLCD PSCQSFKQSI QEALEGKGAP       360
     RQQRLERASM HTYQRRTEAM LECLDFHGLL LPMTGATTHM PNARPLSCQA LESLGVSLLV       420
     LLIGALRILN QNFLSGALRN AGLKRWSCNT RLLYLAADDA IRSGDMRDAR HYMEGLWREN       480
     GQVLALHRLL LKPRRGQVVD QLALFETMMN SNVFPLHFTG YCAVVLGDWS IEIKDPDLRD       540
     GCLNTLTTVI TTLLDDPGTY HCLRPVHENR MQLLVSAQLS RMRLLMAAQF WLELEACGPS       600
     LMRSIADYNP ALIDPQSASR LTTNAVRCLA MEGLMAWWTN DAQRFLASFS EVHRLVVAAD       660
     SLSFDSDSLG GQTEAQAFAA LMLKQLRGCL WRADLGQQRP GRGQLVGFVL LILNNHLNWK       720
     RSDKVQRLLK TLEQTKPA                                                     738
//

If you have problems or comments...

PBIL Back to PBIL home page