(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE226

CP000435.PE226       Location/Qualifiers
FT   CDS             complement(239623..240918)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0229"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45657"
FT                   /db_xref="GOA:Q0IDK7"
FT                   /db_xref="InterPro:IPR007016"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDK7"
FT                   /protein_id="ABI45657.1"
FT                   /translation="MGSSKSHPQLSSQPLVRLTRIFQDISRNLLSNDDLINALIPFSVA
FT                   LHLTKQSRELGLISLFAWLVLQMSAAIRKLILKSSTQATLVAWGGLLGFLLLNARNVIE
FT                   RDDYRGPVQFLLILTGLLISSQFSKKQWLSLLRWLGIAIIPIATWFAWRMHLNDDWSIR
FT                   SIYRIYYEYTKQSMGSINRLATTAGLLTLSAWYSTTQMHQIPARAASLIIAFAGYLIVL
FT                   GTGSRMAIIAVPIAISIPWLWMRINNRLSAKQLIITSIATLGLTGSLAWHFVIAKGFAS
FT                   SDVMRLRMASCWIDKGMLKPTERFWIGTGFDSAKLREACEYIRPGSPFGHAHNTLANIA
FT                   GHHGLLGIIVLISFSMLVAYGLLRQQRVSTKIFSWPPFNSTSWAEISLGLNLTLLIFAA
FT                   STTIYVSSPINQVLIGLGAGSALAWQSPDQSQ"
     MGSSKSHPQL SSQPLVRLTR IFQDISRNLL SNDDLINALI PFSVALHLTK QSRELGLISL        60
     FAWLVLQMSA AIRKLILKSS TQATLVAWGG LLGFLLLNAR NVIERDDYRG PVQFLLILTG       120
     LLISSQFSKK QWLSLLRWLG IAIIPIATWF AWRMHLNDDW SIRSIYRIYY EYTKQSMGSI       180
     NRLATTAGLL TLSAWYSTTQ MHQIPARAAS LIIAFAGYLI VLGTGSRMAI IAVPIAISIP       240
     WLWMRINNRL SAKQLIITSI ATLGLTGSLA WHFVIAKGFA SSDVMRLRMA SCWIDKGMLK       300
     PTERFWIGTG FDSAKLREAC EYIRPGSPFG HAHNTLANIA GHHGLLGIIV LISFSMLVAY       360
     GLLRQQRVST KIFSWPPFNS TSWAEISLGL NLTLLIFAAS TTIYVSSPIN QVLIGLGAGS       420
     ALAWQSPDQS Q                                                            431
//

If you have problems or comments...

PBIL Back to PBIL home page