(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE232

CP000435.PE232       Location/Qualifiers
FT   CDS             complement(248237..248689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0235"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46776"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDK1"
FT                   /protein_id="ABI46776.1"
FT                   /translation="MTSSVKQHQKIRRSRDRRLKGRKLVCPVHQDQIIRGNGKKYFLHL
FT                   LSAEALQRRGMASKTARLVINAYPVFVLSNEWLEELYCEQCGSNHWCHIIKHSPDEYTV
FT                   RWAPQHLWEQVAHVDPSVANPTVSEYTRKQARRHQQKRVDGKRFYG"
     MTSSVKQHQK IRRSRDRRLK GRKLVCPVHQ DQIIRGNGKK YFLHLLSAEA LQRRGMASKT        60
     ARLVINAYPV FVLSNEWLEE LYCEQCGSNH WCHIIKHSPD EYTVRWAPQH LWEQVAHVDP       120
     SVANPTVSEY TRKQARRHQQ KRVDGKRFYG                                        150
//

If you have problems or comments...

PBIL Back to PBIL home page