(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE24

CP000435.PE24        Location/Qualifiers
FT   CDS             30357..30599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0024"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to PIR:AI2111"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46800"
FT                   /db_xref="InterPro:IPR001455"
FT                   /db_xref="InterPro:IPR036868"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IE59"
FT                   /protein_id="ABI46800.1"
FT                   /translation="MSDAQPDHYLDLRGTPCPTNFIRCRLALEAMRPGQHFQVDLDRGE
FT                   PEEMVIPGLTRDGHQVQVMDQASDWVRLLVVCGGA"
     MSDAQPDHYL DLRGTPCPTN FIRCRLALEA MRPGQHFQVD LDRGEPEEMV IPGLTRDGHQ        60
     VQVMDQASDW VRLLVVCGGA                                                    80
//

If you have problems or comments...

PBIL Back to PBIL home page