(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE248

CP000435.PE248       Location/Qualifiers
FT   CDS             259146..259523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0251"
FT                   /product="NUDIX hydrolase"
FT                   /EC_number="3.6.1.13"
FT                   /note="identified by match to protein family HMM PF00293"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45441"
FT                   /db_xref="GOA:Q0IDI5"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDI5"
FT                   /protein_id="ABI45441.1"
FT                   /translation="MILRQYRFAVQARLLEFPAGTLEEGEDPLESMQRELGEEAGYSAA
FT                   RWDSLGPMLPCPGYSDEVIHCFLARDLSRLEHPPAGDDDEDLEVILMSPSELDARLASG
FT                   DEWLDGKSVTAWFRAKQLLGL"
     MILRQYRFAV QARLLEFPAG TLEEGEDPLE SMQRELGEEA GYSAARWDSL GPMLPCPGYS        60
     DEVIHCFLAR DLSRLEHPPA GDDDEDLEVI LMSPSELDAR LASGDEWLDG KSVTAWFRAK       120
     QLLGL                                                                   125
//

If you have problems or comments...

PBIL Back to PBIL home page