(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE250

CP000435.PE250       Location/Qualifiers
FT   CDS             complement(260980..262194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0253"
FT                   /product="DegT/DnrJ/EryC1/StrS aminotransferase family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF01041;
FT                   match to protein family HMM PF01053; match to protein
FT                   family HMM PF01212"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45556"
FT                   /db_xref="GOA:Q0IDI3"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDI3"
FT                   /protein_id="ABI45556.1"
FT                   /translation="MQVPPFSLTDQLADLGSELDNAVLRVLRSGQYIGGAEIKQFEKAF
FT                   AASVNSRHAVGCNSGTDALVLALRGLGIGSGDEVITASFSFFATAEAISAVGATPVFVD
FT                   VDPVTYLIDLNLIEAAITPATKALLPVHLFGRPVDMARIMEIAHSHGLKVVEDCAQATG
FT                   ASWDSKPVGSWGDVGCFSFFPTKNLGAAGDGGAMTCQDDDLAQRMRELAVHGMPRRYLH
FT                   TALGYNSRLDSIQAAVLNVKLPYLSGWVEKRAAIAKRYFEALKDLPGVQLPDSATDASV
FT                   GHGWNQFVVRVGLCPNNQPTCDRTCSESASTLGLPSSRCRDWLKQSLQEQGVNTIIYYP
FT                   IPIHRQPAYEGQAHAEGNLPITDQLCSEVLSLPIFPELTAEQQERVITVLREQLVAQIQ
FT                   ERMVA"
     MQVPPFSLTD QLADLGSELD NAVLRVLRSG QYIGGAEIKQ FEKAFAASVN SRHAVGCNSG        60
     TDALVLALRG LGIGSGDEVI TASFSFFATA EAISAVGATP VFVDVDPVTY LIDLNLIEAA       120
     ITPATKALLP VHLFGRPVDM ARIMEIAHSH GLKVVEDCAQ ATGASWDSKP VGSWGDVGCF       180
     SFFPTKNLGA AGDGGAMTCQ DDDLAQRMRE LAVHGMPRRY LHTALGYNSR LDSIQAAVLN       240
     VKLPYLSGWV EKRAAIAKRY FEALKDLPGV QLPDSATDAS VGHGWNQFVV RVGLCPNNQP       300
     TCDRTCSESA STLGLPSSRC RDWLKQSLQE QGVNTIIYYP IPIHRQPAYE GQAHAEGNLP       360
     ITDQLCSEVL SLPIFPELTA EQQERVITVL REQLVAQIQE RMVA                        404
//

If you have problems or comments...

PBIL Back to PBIL home page