(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE253

CP000435.PE253       Location/Qualifiers
FT   CDS             complement(263394..263858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0256"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45890"
FT                   /db_xref="InterPro:IPR036155"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDI0"
FT                   /protein_id="ABI45890.1"
FT                   /translation="MPQHTPQYPAILMDPSKPILWVHEEALGPANPALQDYPNAPGLFV
FT                   FDDTWIEDQSISRKRIGFLYESALSLPLTLRRGDVAREVLGFAQRHGADAVVTSTVVDP
FT                   RLQRIAAAIDRELPLWMLDPDPFVELHKPPRLGRFSRYWREAEPVVWETF"
     MPQHTPQYPA ILMDPSKPIL WVHEEALGPA NPALQDYPNA PGLFVFDDTW IEDQSISRKR        60
     IGFLYESALS LPLTLRRGDV AREVLGFAQR HGADAVVTST VVDPRLQRIA AAIDRELPLW       120
     MLDPDPFVEL HKPPRLGRFS RYWREAEPVV WETF                                   154
//

If you have problems or comments...

PBIL Back to PBIL home page