(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE256

CP000435.PE256       Location/Qualifiers
FT   CDS             265659..266558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0259"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47891"
FT                   /db_xref="GOA:Q0IDH7"
FT                   /db_xref="InterPro:IPR021134"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDH7"
FT                   /protein_id="ABI47891.1"
FT                   /translation="MIRPRGCLDYLKLSWWLIVHQGKSLLLATLLCAISLPLNEIISTA
FT                   LLPEALVQVLGLLLSLFLGFRYSQAYNRWLEARVLWGALVNHSRSWRDLLVRVLPRQLP
FT                   LSWKRRLLQEVVLLVWCLNAQLRSSKGSAVLLPEPVRELGVKIGLRNLSVQSLLKRMAR
FT                   EQHLLRQGGWVDSFQSSEFGLLQQAFTNVIGGLERIRHQPLPASSTFFIRGMTWVYGYL
FT                   VFLKLDALGHISAALLGWLVFLIFLMAERIGTFIERPFVDARFALPMDHFCALISLDLL
FT                   GASSPLAKPSSTKGPWLR"
     MIRPRGCLDY LKLSWWLIVH QGKSLLLATL LCAISLPLNE IISTALLPEA LVQVLGLLLS        60
     LFLGFRYSQA YNRWLEARVL WGALVNHSRS WRDLLVRVLP RQLPLSWKRR LLQEVVLLVW       120
     CLNAQLRSSK GSAVLLPEPV RELGVKIGLR NLSVQSLLKR MAREQHLLRQ GGWVDSFQSS       180
     EFGLLQQAFT NVIGGLERIR HQPLPASSTF FIRGMTWVYG YLVFLKLDAL GHISAALLGW       240
     LVFLIFLMAE RIGTFIERPF VDARFALPMD HFCALISLDL LGASSPLAKP SSTKGPWLR        299
//

If you have problems or comments...

PBIL Back to PBIL home page