(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE258

CP000435.PE258       Location/Qualifiers
FT   CDS             267274..268788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0261"
FT                   /product="Retinal pigment epithelial membrane protein"
FT                   /note="identified by match to protein family HMM PF03055"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46919"
FT                   /db_xref="GOA:Q0IDH5"
FT                   /db_xref="InterPro:IPR004294"
FT                   /db_xref="InterPro:IPR011048"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDH5"
FT                   /protein_id="ABI46919.1"
FT                   /translation="MRLGSPVTVAPTSARFNRSEWSSAFRNVEEELTDVPLKPVRGAVP
FT                   DALRGTLYRNGPGRLERDGQRVHHPFDGDGMITALHFDADGVRCSNRFVRTSGWKAEEA
FT                   AGKVLFRGVFGSQKPGGPLANAFDLRLKNIANTSVVRLGDDLLALWEAAEPYALDPQTL
FT                   ETRGLSLLGGVLKRGEAFSAHPRFDPGHHGDPRMVTFGVKTGPRSTIRLMEFATEDNAA
FT                   AGIRAGDLLSDRRDTFAGFAFLHDFAITPNWAVFLQNAINFNPLPFVLGQKGAAQCLTS
FT                   NPNGKAKFWLIPRDSGTFAGQEPRVIDAPDGFVFHHLNAWEEDGDVVVESIYYSDFPSI
FT                   GPDQDFADVNFDLIPEGLLEQCRINLISEKVDTTRLSERCCEFAMVNPNQEGLPCRFAW
FT                   MAAAARERGNDPLQVVKKLDLQTGEKLIWSAAPSGFVSEPIMIPRPNASDEDDGWVLDL
FT                   VWNGARDASDLYILDARDLSEVALLELPLAIPHGLHGSWSESSLQP"
     MRLGSPVTVA PTSARFNRSE WSSAFRNVEE ELTDVPLKPV RGAVPDALRG TLYRNGPGRL        60
     ERDGQRVHHP FDGDGMITAL HFDADGVRCS NRFVRTSGWK AEEAAGKVLF RGVFGSQKPG       120
     GPLANAFDLR LKNIANTSVV RLGDDLLALW EAAEPYALDP QTLETRGLSL LGGVLKRGEA       180
     FSAHPRFDPG HHGDPRMVTF GVKTGPRSTI RLMEFATEDN AAAGIRAGDL LSDRRDTFAG       240
     FAFLHDFAIT PNWAVFLQNA INFNPLPFVL GQKGAAQCLT SNPNGKAKFW LIPRDSGTFA       300
     GQEPRVIDAP DGFVFHHLNA WEEDGDVVVE SIYYSDFPSI GPDQDFADVN FDLIPEGLLE       360
     QCRINLISEK VDTTRLSERC CEFAMVNPNQ EGLPCRFAWM AAAARERGND PLQVVKKLDL       420
     QTGEKLIWSA APSGFVSEPI MIPRPNASDE DDGWVLDLVW NGARDASDLY ILDARDLSEV       480
     ALLELPLAIP HGLHGSWSES SLQP                                              504
//

If you have problems or comments...

PBIL Back to PBIL home page