(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE260

CP000435.PE260       Location/Qualifiers
FT   CDS             271865..273304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0263"
FT                   /product="two component sensor histidine kinase, putative"
FT                   /note="identified by match to protein family HMM PF00512;
FT                   match to protein family HMM PF00672; match to protein
FT                   family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46774"
FT                   /db_xref="GOA:Q0IDH3"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDH3"
FT                   /protein_id="ABI46774.1"
FT                   /translation="MTQHNISIRRRLGYSLVGLFTISFGILLIATNQIIKRDRLQRHER
FT                   LVMATAMAIKTEFEDVSQKPVGQEESLDNQRYRQILNNFSATRVLVWLSRPEADPLFPN
FT                   TATVQQFFGNPKLLEAAGVNASGMQKPRSFVFDGQTYFTCSMPLPGNQGVLRFLEDVGV
FT                   SPAGRQENLIFLFVVWIFSVAIATVLIRRFLTSSLLPLIKLESVMDDMSLRPTGLVSEK
FT                   RVPIESQPNELQGIVKSYNRLADRLQESWSNQLLFIRAVSHELITPLTLINSSARRLDR
FT                   RLTDLSDSDRKLLASIRKEVWDADHLVRDLVDLARSESGSLKLKLSSVKAMDVIADLSA
FT                   ELEPLAWGNRVQTPSPENLSIVETVMISVNSDRLRQCIINVLENASKYSPEDAPIDLSV
FT                   TSDDCNIYFDVQDYGPGISQEDQRTIFKPFQRGKSDLNDVPGGGIGLALVHQIVRLMNG
FT                   SIYILSSGESGTIMRFEFPIE"
     MTQHNISIRR RLGYSLVGLF TISFGILLIA TNQIIKRDRL QRHERLVMAT AMAIKTEFED        60
     VSQKPVGQEE SLDNQRYRQI LNNFSATRVL VWLSRPEADP LFPNTATVQQ FFGNPKLLEA       120
     AGVNASGMQK PRSFVFDGQT YFTCSMPLPG NQGVLRFLED VGVSPAGRQE NLIFLFVVWI       180
     FSVAIATVLI RRFLTSSLLP LIKLESVMDD MSLRPTGLVS EKRVPIESQP NELQGIVKSY       240
     NRLADRLQES WSNQLLFIRA VSHELITPLT LINSSARRLD RRLTDLSDSD RKLLASIRKE       300
     VWDADHLVRD LVDLARSESG SLKLKLSSVK AMDVIADLSA ELEPLAWGNR VQTPSPENLS       360
     IVETVMISVN SDRLRQCIIN VLENASKYSP EDAPIDLSVT SDDCNIYFDV QDYGPGISQE       420
     DQRTIFKPFQ RGKSDLNDVP GGGIGLALVH QIVRLMNGSI YILSSGESGT IMRFEFPIE        479
//

If you have problems or comments...

PBIL Back to PBIL home page