(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE275

CP000435.PE275       Location/Qualifiers
FT   CDS             288534..289811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0279"
FT                   /product="Conserved membrane protein containing two CBS
FT                   domains"
FT                   /note="identified by match to protein family HMM PF00571;
FT                   match to protein family HMM PF01595; match to protein
FT                   family HMM PF03471"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46507"
FT                   /db_xref="GOA:Q0IDF8"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDF8"
FT                   /protein_id="ABI46507.1"
FT                   /translation="MRNLLLIALLVLPAFFAASELALLRLRPSRVHELREEGLPGAPAV
FT                   ERLQRRLRTALLMTQFGTTLSLVALGWIARGFGQRWWPMETPAGRWWDLAWFLVLVILA
FT                   TLLSGLLPRALVLSRPEPAALELSPVLETTMQVLRPLLSVLEVIASLLLRLVGLKPRWD
FT                   ALVPALTAGELETLVESGGVTGLRPDERNILEGVFALRDMQVREVMVPRSGMVTLPVEV
FT                   RFAELMEAVHRTRHARFPVIGQSLDDVRGVLDLRRLAEPIARGELQKHSALEPYLSPAE
FT                   RVLETSNLAELLAIIRSGHPLLLVVDEHGGTEGLVTAADLTGEIVGDEPEHESAEPDLQ
FT                   AIEGEEGAWLVAGDLEILELNRQLDLDLPEASEHHTLAGFLLERLQHIPAAGEALRHNG
FT                   VQFEIITMRGPRIVQVRLVIPGVTNL"
     MRNLLLIALL VLPAFFAASE LALLRLRPSR VHELREEGLP GAPAVERLQR RLRTALLMTQ        60
     FGTTLSLVAL GWIARGFGQR WWPMETPAGR WWDLAWFLVL VILATLLSGL LPRALVLSRP       120
     EPAALELSPV LETTMQVLRP LLSVLEVIAS LLLRLVGLKP RWDALVPALT AGELETLVES       180
     GGVTGLRPDE RNILEGVFAL RDMQVREVMV PRSGMVTLPV EVRFAELMEA VHRTRHARFP       240
     VIGQSLDDVR GVLDLRRLAE PIARGELQKH SALEPYLSPA ERVLETSNLA ELLAIIRSGH       300
     PLLLVVDEHG GTEGLVTAAD LTGEIVGDEP EHESAEPDLQ AIEGEEGAWL VAGDLEILEL       360
     NRQLDLDLPE ASEHHTLAGF LLERLQHIPA AGEALRHNGV QFEIITMRGP RIVQVRLVIP       420
     GVTNL                                                                   425
//

If you have problems or comments...

PBIL Back to PBIL home page