(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE277

CP000435.PE277       Location/Qualifiers
FT   CDS             complement(290871..293993)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0281"
FT                   /product="phosphorylase kinase alpha chain"
FT                   /EC_number="2.7.11.19"
FT                   /note="identified by match to protein family HMM PF05682"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45270"
FT                   /db_xref="GOA:Q0IDF6"
FT                   /db_xref="InterPro:IPR008734"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR011613"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDF6"
FT                   /protein_id="ABI45270.1"
FT                   /translation="MAIDAVVLQRQHPVSGLLPASTANTVHGNYGDAWVRDCVYSIQCV
FT                   WGLAIAHRRLQRGTTQRSWELEQRVLGLMRGLLNSMMRQASKVERFKHSLDPLDALHAK
FT                   YNSANGDQVVADDGWGHLQLDATSLFLLQLAQLSRGGLAVIRNRHEVAFIQNLVYYVAR
FT                   AYRVPDYGIWERGDKGNQGLPERNASSIGMAKAALEALDGVDLFSSHGDGSMQVLVPQG
FT                   AVVRLRRALQGLLPRESASKEVDSACLSVIGYPAWAVEERDLVERTIQRIRRELGGPYG
FT                   YKRFRRDGHQTVIEDVSRLHYERAELVNFEGVESEWPLFLAYEQLTACCEKRWTDAHYW
FT                   QERLKILQVECHGQQLYPELYLVPDSAVELERRAPGSQQRLANDNVPLLWTQSLAWLGE
FT                   MLIEGLIEPADLDPCGRRFQAEIGAEQVLVALAPTSSALADELKARGLPVSDPQTSLIQ
FT                   VVPSSNLNDRLSAVGGDEALRLSGQPMLRADTSDTARLYQQDDEKFAVLPAVLEEDTFF
FT                   VSHDPRQLMETVINELHLLQRHWRGEGSPLLLIPVEASLLENNPELLMDLTRRLHSGRI
FT                   EDVPVCFSDLETLAQSAQWVTLPAATARNNTHQRSDATRYLQASTDFSDLTAAQEQELD
FT                   DIPLGELRDRLWSSHSLREQAEVLELLKRQLGHRAILSGPQGTPVELVTLLEEIYHRGL
FT                   SQEDWNVARRCAGAMGLVHPQLEDAVIDLLSRQKQVVVGRNYTSDSRLSAPASSPAIAA
FT                   LIERTCGNDGRERMLQQELLVALDGLARREPEKLKGTLTLQLGQLLLLLTSELAAERQL
FT                   SQDEAFEALCSEAPHAISLRLQALLNDVDHARAALQRRELLHLRGHVQWSVPEPLEERP
FT                   SGSDWLQHRMRLGSLQQVPKEFYAGIWSLLHHCRGLVIGDKLERRNRLTSALVLEKTPG
FT                   ERNFAIQVEHLLSRIEAAEYRQLCTESLLSLMAFTMTNPDMRFEDDIALDVVIGHAVRV
FT                   GWQSTYPEQDTGAYSQHKAAAWEQFYQASPAQCRRWQIKALKELAEQEGLL"
     MAIDAVVLQR QHPVSGLLPA STANTVHGNY GDAWVRDCVY SIQCVWGLAI AHRRLQRGTT        60
     QRSWELEQRV LGLMRGLLNS MMRQASKVER FKHSLDPLDA LHAKYNSANG DQVVADDGWG       120
     HLQLDATSLF LLQLAQLSRG GLAVIRNRHE VAFIQNLVYY VARAYRVPDY GIWERGDKGN       180
     QGLPERNASS IGMAKAALEA LDGVDLFSSH GDGSMQVLVP QGAVVRLRRA LQGLLPRESA       240
     SKEVDSACLS VIGYPAWAVE ERDLVERTIQ RIRRELGGPY GYKRFRRDGH QTVIEDVSRL       300
     HYERAELVNF EGVESEWPLF LAYEQLTACC EKRWTDAHYW QERLKILQVE CHGQQLYPEL       360
     YLVPDSAVEL ERRAPGSQQR LANDNVPLLW TQSLAWLGEM LIEGLIEPAD LDPCGRRFQA       420
     EIGAEQVLVA LAPTSSALAD ELKARGLPVS DPQTSLIQVV PSSNLNDRLS AVGGDEALRL       480
     SGQPMLRADT SDTARLYQQD DEKFAVLPAV LEEDTFFVSH DPRQLMETVI NELHLLQRHW       540
     RGEGSPLLLI PVEASLLENN PELLMDLTRR LHSGRIEDVP VCFSDLETLA QSAQWVTLPA       600
     ATARNNTHQR SDATRYLQAS TDFSDLTAAQ EQELDDIPLG ELRDRLWSSH SLREQAEVLE       660
     LLKRQLGHRA ILSGPQGTPV ELVTLLEEIY HRGLSQEDWN VARRCAGAMG LVHPQLEDAV       720
     IDLLSRQKQV VVGRNYTSDS RLSAPASSPA IAALIERTCG NDGRERMLQQ ELLVALDGLA       780
     RREPEKLKGT LTLQLGQLLL LLTSELAAER QLSQDEAFEA LCSEAPHAIS LRLQALLNDV       840
     DHARAALQRR ELLHLRGHVQ WSVPEPLEER PSGSDWLQHR MRLGSLQQVP KEFYAGIWSL       900
     LHHCRGLVIG DKLERRNRLT SALVLEKTPG ERNFAIQVEH LLSRIEAAEY RQLCTESLLS       960
     LMAFTMTNPD MRFEDDIALD VVIGHAVRVG WQSTYPEQDT GAYSQHKAAA WEQFYQASPA      1020
     QCRRWQIKAL KELAEQEGLL                                                  1040
//

If you have problems or comments...

PBIL Back to PBIL home page