(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE300

CP000435.PE300       Location/Qualifiers
FT   CDS             314852..315325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0305"
FT                   /product="Pentapeptide repeats"
FT                   /note="identified by match to protein family HMM PF00805"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45862"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDD3"
FT                   /protein_id="ABI45862.1"
FT                   /translation="MTFLLKRIWCAFGSMALVLGPSAVEAGSVTAIAVEPFGTPLERLL
FT                   ESGACQGCDLRDADLRGRHLIGADLRDADLRGAQLSGVNLEGADLSGARLDGARLQGAM
FT                   LSNADLSDSDLRHADLRDSVVINAYAPGVQTEGMQFAGSDLTGSHLIYGGGPD"
     MTFLLKRIWC AFGSMALVLG PSAVEAGSVT AIAVEPFGTP LERLLESGAC QGCDLRDADL        60
     RGRHLIGADL RDADLRGAQL SGVNLEGADL SGARLDGARL QGAMLSNADL SDSDLRHADL       120
     RDSVVINAYA PGVQTEGMQF AGSDLTGSHL IYGGGPD                                157
//

If you have problems or comments...

PBIL Back to PBIL home page