(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE308

CP000435.PE308       Location/Qualifiers
FT   CDS             323165..323422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0313"
FT                   /product="Uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47226"
FT                   /db_xref="InterPro:IPR021492"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDC5"
FT                   /protein_id="ABI47226.1"
FT                   /translation="MAALPVTTAHLRVQRQSFADQCLEGDVQAGGFNWQFSWFFDRGEL
FT                   SVEPSLGRALIQDALLRFLVKSDYDLEPGGDYTFTVRARF"
     MAALPVTTAH LRVQRQSFAD QCLEGDVQAG GFNWQFSWFF DRGELSVEPS LGRALIQDAL        60
     LRFLVKSDYD LEPGGDYTFT VRARF                                              85
//

If you have problems or comments...

PBIL Back to PBIL home page