(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE309

CP000435.PE309       Location/Qualifiers
FT   CDS             complement(323400..323852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0314"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:CAE22008.1"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46424"
FT                   /db_xref="GOA:Q0IDC4"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDC4"
FT                   /protein_id="ABI46424.1"
FT                   /translation="MTRVVALDPGRSKCGLLLANISTNTVLKAMVIPSAEVLDQLRAWM
FT                   EDDQGENAQIADLVIGDGTSSTIWQQQLPTSLKVHVVDETGTTLRARERYWQLWPARGW
FT                   KRLLPLGLRIPSGDLDAIAALVILEDYLDRPLQWPGPDPLKNGPSR"
     MTRVVALDPG RSKCGLLLAN ISTNTVLKAM VIPSAEVLDQ LRAWMEDDQG ENAQIADLVI        60
     GDGTSSTIWQ QQLPTSLKVH VVDETGTTLR ARERYWQLWP ARGWKRLLPL GLRIPSGDLD       120
     AIAALVILED YLDRPLQWPG PDPLKNGPSR                                        150
//

If you have problems or comments...

PBIL Back to PBIL home page