(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE310

CP000435.PE310       Location/Qualifiers
FT   CDS             complement(323849..324898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0315"
FT                   /product="Uncharacterized conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45610"
FT                   /db_xref="GOA:Q0IDC3"
FT                   /db_xref="InterPro:IPR021435"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDC3"
FT                   /protein_id="ABI45610.1"
FT                   /translation="MGKARLSLLGLRPKRTAVVITVLTGSLISALSLGLLLLVSRQLRV
FT                   GLFELNALEAKLRSSRSDLKTSKRAQKQAGKELTTAQQRAAELRRTLKPLQEQTRSLEA
FT                   ERQRLSQDVDAKDVEIQRTEQELSAVRSQIRSGEKELNELEDTLLALRRGNVAISSGQP
FT                   LTTVTLKLERPDQAKTVIDQLLRDANLQAYQQVLPGQPVERQLLLVPRPDIKRLEQTIR
FT                   KPGTWVVNIRSAANVLLGETVVYAFPEVLPNVTVTREGEILARTTVASNERNPEAVRNR
FT                   LNLLLASTLAEVQRRGSLSKGLQFDGNAINALGQELIDRNGGLATLEAVALRRSETADP
FT                   IAIQLRLSP"
     MGKARLSLLG LRPKRTAVVI TVLTGSLISA LSLGLLLLVS RQLRVGLFEL NALEAKLRSS        60
     RSDLKTSKRA QKQAGKELTT AQQRAAELRR TLKPLQEQTR SLEAERQRLS QDVDAKDVEI       120
     QRTEQELSAV RSQIRSGEKE LNELEDTLLA LRRGNVAISS GQPLTTVTLK LERPDQAKTV       180
     IDQLLRDANL QAYQQVLPGQ PVERQLLLVP RPDIKRLEQT IRKPGTWVVN IRSAANVLLG       240
     ETVVYAFPEV LPNVTVTREG EILARTTVAS NERNPEAVRN RLNLLLASTL AEVQRRGSLS       300
     KGLQFDGNAI NALGQELIDR NGGLATLEAV ALRRSETADP IAIQLRLSP                   349
//

If you have problems or comments...

PBIL Back to PBIL home page