(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE318

CP000435.PE318       Location/Qualifiers
FT   CDS             complement(329914..331989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0323"
FT                   /product="transglycosylase, SLT family protein"
FT                   /note="identified by match to protein family HMM PF01464"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45427"
FT                   /db_xref="GOA:Q0IDB5"
FT                   /db_xref="InterPro:IPR000189"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR008939"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDB5"
FT                   /protein_id="ABI45427.1"
FT                   /translation="MPPVSGRGLTVQHSRGLLLLAGTPLLTVALVLGGQTLMRRLHTPL
FT                   TPSISNADLWTHYRWSINPSERREAALLLAARSADSADRSQRLLANQGWGNDPIAAVTL
FT                   KQQALTAAKLGQPSEEQKRWQDLLQRFPDSAASADARYQLGQAHPALHTELFRQQPGHP
FT                   AALAAAAETKTESPKQAIAALHLARWGARWPGAATQLREACNRISGDGLNQDDRLTLAR
FT                   GLASLGDGGAAEACLQGTPTTPASALAIGRVLLRGTAEQQGRGKQHLLELAINNPDDPA
FT                   ALEAAALLSEPLKPDPALLDALPQALQQRSADVAAARVRLGDSANGDASNAMSVLKRWP
FT                   TNPAAWQLQWDLAREALLKDQWQTAESLLRAIPSSNLPEPLAARQQFWLGLTLSKQDQT
FT                   TQAQQVWQHLVKTHPRSYYTWRAEVRLGRGDLPDLHQASASRSAGLGDSFQSPWEPLQS
FT                   GDSFVDRLWRLGQTQEAWETWRNQQPPSDQPTNPEQKLVEGRLRIAVGDSWTGLSRLWR
FT                   ASLRLVNQSCEERQLLHRSQHPRLLSQVFERASQQEAVRNELLMAIAKQESRFSPGVSS
FT                   PVGAVGLLQLMPATAEELAGDALSQDQLREPTRNARLGARYLGHLLEQWQGDIVLAVAS
FT                   YNAGPGAASQWVTPALKNDPELWIERIPYPETRLYTKKVLGNLWAYLGSGTDRCDS"
     MPPVSGRGLT VQHSRGLLLL AGTPLLTVAL VLGGQTLMRR LHTPLTPSIS NADLWTHYRW        60
     SINPSERREA ALLLAARSAD SADRSQRLLA NQGWGNDPIA AVTLKQQALT AAKLGQPSEE       120
     QKRWQDLLQR FPDSAASADA RYQLGQAHPA LHTELFRQQP GHPAALAAAA ETKTESPKQA       180
     IAALHLARWG ARWPGAATQL REACNRISGD GLNQDDRLTL ARGLASLGDG GAAEACLQGT       240
     PTTPASALAI GRVLLRGTAE QQGRGKQHLL ELAINNPDDP AALEAAALLS EPLKPDPALL       300
     DALPQALQQR SADVAAARVR LGDSANGDAS NAMSVLKRWP TNPAAWQLQW DLAREALLKD       360
     QWQTAESLLR AIPSSNLPEP LAARQQFWLG LTLSKQDQTT QAQQVWQHLV KTHPRSYYTW       420
     RAEVRLGRGD LPDLHQASAS RSAGLGDSFQ SPWEPLQSGD SFVDRLWRLG QTQEAWETWR       480
     NQQPPSDQPT NPEQKLVEGR LRIAVGDSWT GLSRLWRASL RLVNQSCEER QLLHRSQHPR       540
     LLSQVFERAS QQEAVRNELL MAIAKQESRF SPGVSSPVGA VGLLQLMPAT AEELAGDALS       600
     QDQLREPTRN ARLGARYLGH LLEQWQGDIV LAVASYNAGP GAASQWVTPA LKNDPELWIE       660
     RIPYPETRLY TKKVLGNLWA YLGSGTDRCD S                                      691
//

If you have problems or comments...

PBIL Back to PBIL home page