(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE321

CP000435.PE321       Location/Qualifiers
FT   CDS             complement(333648..334640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0326"
FT                   /product="BadF/BadG/BcrA/BcrD ATPase family superfamily"
FT                   /note="identified by match to protein family HMM PF01869"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47590"
FT                   /db_xref="InterPro:IPR002731"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDB2"
FT                   /protein_id="ABI47590.1"
FT                   /translation="MVLPGNPESGPTSHPDRPMSDALILAGFDAGQTHCRCKLSRWHNG
FT                   NWQPLGEGKGSGVSHLQANEGETRFVEAIRSSLDAANPSGLEINAAAVGASGVEQGTAL
FT                   QDRASELLAASLALPIEHCIATGDERIALRGAFPNDAGIVLISGTGMIVVGRNASGLEQ
FT                   RCGGWGWQLDGAGAAFDLGHQGLQLSLRMADGRLPDGPLRNQLWQVLGCRTAAAIKAFV
FT                   VQPNYQPAQLAQLAPLVSAAAEAGNIEAKAILDRSGDALAEAVQAVASSLGLTQPVLCA
FT                   RGGALLNLAPLQQAVNTSLRRRQVDARWDDRSGDACDGALTLALERCRS"
     MVLPGNPESG PTSHPDRPMS DALILAGFDA GQTHCRCKLS RWHNGNWQPL GEGKGSGVSH        60
     LQANEGETRF VEAIRSSLDA ANPSGLEINA AAVGASGVEQ GTALQDRASE LLAASLALPI       120
     EHCIATGDER IALRGAFPND AGIVLISGTG MIVVGRNASG LEQRCGGWGW QLDGAGAAFD       180
     LGHQGLQLSL RMADGRLPDG PLRNQLWQVL GCRTAAAIKA FVVQPNYQPA QLAQLAPLVS       240
     AAAEAGNIEA KAILDRSGDA LAEAVQAVAS SLGLTQPVLC ARGGALLNLA PLQQAVNTSL       300
     RRRQVDARWD DRSGDACDGA LTLALERCRS                                        330
//

If you have problems or comments...

PBIL Back to PBIL home page