(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE322

CP000435.PE322       Location/Qualifiers
FT   CDS             complement(334583..335926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0327"
FT                   /product="putative inorganic carbon transporter/0-antigen
FT                   polymerase (ICT/OAP) family protein"
FT                   /note="identified by match to protein family HMM PF04932"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46943"
FT                   /db_xref="GOA:Q0IDB1"
FT                   /db_xref="InterPro:IPR006007"
FT                   /db_xref="InterPro:IPR007016"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDB1"
FT                   /protein_id="ABI46943.1"
FT                   /translation="MIIPKTLHPHLMAEAPAPPPLLLSWQGVLPASEQQRRRLSWLASI
FT                   LLMVLLAGLPFLTRTGLGLVVLACGALWILWSSVSQPQRIGAISAWVLLFLGIALLATG
FT                   FSPVPAAATKGLIKLLSYLGVYALMRQLLAERPDWWDRLVAALLGGELLTSVMALRQLY
FT                   GPTEELARWADPNSVAAGTIRIYGPLGNPNLLAGYLVPILPLALVALIRWNGWGARCYA
FT                   AVALGLGATATLFSYSRGGWLGMLAALGVLLLLLVLRAIRNWPKLWRRLVPIALLVLAG
FT                   VALAIAVTQVDPIRTRVASLLAGRGDSSNNFRINVWLAAVEMIQDRPWLGIGPGNAAFN
FT                   AVYPLYQQPKFNALSAYSVPLELLVETGIPGLIAALGLAGASLRNGLRALRSTAALALP
FT                   WLGCLAAIAGLVIQGATDTIFFRPEVQIIGWFCLATLSQAQQATQTDP"
     MIIPKTLHPH LMAEAPAPPP LLLSWQGVLP ASEQQRRRLS WLASILLMVL LAGLPFLTRT        60
     GLGLVVLACG ALWILWSSVS QPQRIGAISA WVLLFLGIAL LATGFSPVPA AATKGLIKLL       120
     SYLGVYALMR QLLAERPDWW DRLVAALLGG ELLTSVMALR QLYGPTEELA RWADPNSVAA       180
     GTIRIYGPLG NPNLLAGYLV PILPLALVAL IRWNGWGARC YAAVALGLGA TATLFSYSRG       240
     GWLGMLAALG VLLLLLVLRA IRNWPKLWRR LVPIALLVLA GVALAIAVTQ VDPIRTRVAS       300
     LLAGRGDSSN NFRINVWLAA VEMIQDRPWL GIGPGNAAFN AVYPLYQQPK FNALSAYSVP       360
     LELLVETGIP GLIAALGLAG ASLRNGLRAL RSTAALALPW LGCLAAIAGL VIQGATDTIF       420
     FRPEVQIIGW FCLATLSQAQ QATQTDP                                           447
//

If you have problems or comments...

PBIL Back to PBIL home page