(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE325

CP000435.PE325       Location/Qualifiers
FT   CDS             337929..338540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0330"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45757"
FT                   /db_xref="GOA:Q0IDA8"
FT                   /db_xref="InterPro:IPR021515"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDA8"
FT                   /protein_id="ABI45757.1"
FT                   /translation="MPDLPYRSLVWLTYRLGATFALGVPLVLLIWAGVRREPAMVRLLS
FT                   LYWKVASLLPISVLLLTDRRPIGYVMAFIAPVLMVVSVWFWVDLNEELADSAPGSALPL
FT                   TVRIWRWALSGFALLAAGMSATALRCANQLSGPECMAWLEGPQGLHRVAERLFDFVFGG
FT                   QWSEAVAAFIGYVALVAYVVGLLQWLLVRLPRQGRVAGEF"
     MPDLPYRSLV WLTYRLGATF ALGVPLVLLI WAGVRREPAM VRLLSLYWKV ASLLPISVLL        60
     LTDRRPIGYV MAFIAPVLMV VSVWFWVDLN EELADSAPGS ALPLTVRIWR WALSGFALLA       120
     AGMSATALRC ANQLSGPECM AWLEGPQGLH RVAERLFDFV FGGQWSEAVA AFIGYVALVA       180
     YVVGLLQWLL VRLPRQGRVA GEF                                               203
//

If you have problems or comments...

PBIL Back to PBIL home page