(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE339

CP000435.PE339       Location/Qualifiers
FT   CDS             complement(350929..351270)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0345"
FT                   /product="Uncharacterized secreted or membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47058"
FT                   /db_xref="GOA:Q0ID94"
FT                   /db_xref="InterPro:IPR007572"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ID94"
FT                   /protein_id="ABI47058.1"
FT                   /translation="MTARLQKTRLQISFGEATSRLDQWAVNPWRRASLMLIALGASFAL
FT                   GNSIGAIAGALALMDPVAALVTVAIWELMVRTRRHWARDRQKHLGRDLLDMSRIGLLYG
FT                   LLLEGFKLL"
     MTARLQKTRL QISFGEATSR LDQWAVNPWR RASLMLIALG ASFALGNSIG AIAGALALMD        60
     PVAALVTVAI WELMVRTRRH WARDRQKHLG RDLLDMSRIG LLYGLLLEGF KLL              113
//

If you have problems or comments...

PBIL Back to PBIL home page