(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE343

CP000435.PE343       Location/Qualifiers
FT   CDS             complement(352723..354570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0349"
FT                   /product="beta-lactamase, putative"
FT                   /note="identified by match to protein family HMM PF00144"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45463"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ID90"
FT                   /protein_id="ABI45463.1"
FT                   /translation="MIHSALDLNNIFLKINQKAKDGIKKATTISAIAATGMVLTTALPS
FT                   SASEWTARHGLSSSSYQQTFNNYTKKGYCLKSISGYQQAGKANYAAIWSKNECKPFIAR
FT                   HGLSPQKYQAAFNAFNKKGYRLTYINGYEIGGKPFYAAIWEKTSGPAYEARHGLTEKQY
FT                   QSQVTSMSGKGYGIKHVSAFSLKGSPRFAVIFEKNMPTWKARHGLTHSQYQKEFNKSAK
FT                   EGYRLKVVTGYRKGNSDRYAAVWTKEGGQYYQARHSIPTKNYQHIFDNYRYQSYEPKYI
FT                   EAFNSASGVKFNGVWENKKFASKSLRSIERKVGQYMRDNNIKGLSIAISKNNKLVYARG
FT                   FGKADITKGIAVGPKHRFRIASVSKLVTQAAIKKLLKETSLNSNSKVFGKNSILGDDYP
FT                   TPSTNPNIDKITIQHLLNHHAGLTNINKNGDKKDPMFSYSGSTFTGLINWTLSNYPLAS
FT                   NPGQKKQYSNFGYSLLGRVIEKATNADYDSYVKNKILNPAGAKGMVIGRDKKNQQLRNE
FT                   ATYYGGGAYSSVKPQRFDSHGGWIATPIDLLRFMRHNNDHGSSHYGLMDGTAAVYKKNY
FT                   NSNFGYAAATNSRKDPAVLNSLMQDIVNSTSSWPSVNMF"
     MIHSALDLNN IFLKINQKAK DGIKKATTIS AIAATGMVLT TALPSSASEW TARHGLSSSS        60
     YQQTFNNYTK KGYCLKSISG YQQAGKANYA AIWSKNECKP FIARHGLSPQ KYQAAFNAFN       120
     KKGYRLTYIN GYEIGGKPFY AAIWEKTSGP AYEARHGLTE KQYQSQVTSM SGKGYGIKHV       180
     SAFSLKGSPR FAVIFEKNMP TWKARHGLTH SQYQKEFNKS AKEGYRLKVV TGYRKGNSDR       240
     YAAVWTKEGG QYYQARHSIP TKNYQHIFDN YRYQSYEPKY IEAFNSASGV KFNGVWENKK       300
     FASKSLRSIE RKVGQYMRDN NIKGLSIAIS KNNKLVYARG FGKADITKGI AVGPKHRFRI       360
     ASVSKLVTQA AIKKLLKETS LNSNSKVFGK NSILGDDYPT PSTNPNIDKI TIQHLLNHHA       420
     GLTNINKNGD KKDPMFSYSG STFTGLINWT LSNYPLASNP GQKKQYSNFG YSLLGRVIEK       480
     ATNADYDSYV KNKILNPAGA KGMVIGRDKK NQQLRNEATY YGGGAYSSVK PQRFDSHGGW       540
     IATPIDLLRF MRHNNDHGSS HYGLMDGTAA VYKKNYNSNF GYAAATNSRK DPAVLNSLMQ       600
     DIVNSTSSWP SVNMF                                                        615
//

If you have problems or comments...

PBIL Back to PBIL home page