(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE352

CP000435.PE352       Location/Qualifiers
FT   CDS             complement(363124..363600)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0359"
FT                   /product="Cupin superfamily (DUF985) superfamily"
FT                   /note="identified by match to protein family HMM PF06172"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46254"
FT                   /db_xref="InterPro:IPR009327"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR039935"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ID81"
FT                   /protein_id="ABI46254.1"
FT                   /translation="MNKRNPSEVVEKLVEEWKLQPHPEGGWYRELHRSSVLVIRPDQQQ
FT                   RCAISTILYLLDSGSLSRWHRVSHADEVWTHLQGAPLSLWCLKPKADQATREVLSMHNP
FT                   VQVIPADHWQAAKAEGPYSLVSCCVGPGFSFEDFTMLRDLPESERPTAALPDLI"
     MNKRNPSEVV EKLVEEWKLQ PHPEGGWYRE LHRSSVLVIR PDQQQRCAIS TILYLLDSGS        60
     LSRWHRVSHA DEVWTHLQGA PLSLWCLKPK ADQATREVLS MHNPVQVIPA DHWQAAKAEG       120
     PYSLVSCCVG PGFSFEDFTM LRDLPESERP TAALPDLI                               158
//

If you have problems or comments...

PBIL Back to PBIL home page