(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE354

CP000435.PE354       Location/Qualifiers
FT   CDS             365053..366873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0361"
FT                   /product="Glycosidase"
FT                   /EC_number="2.4.1.7"
FT                   /note="identified by match to protein family HMM PF00128"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45857"
FT                   /db_xref="GOA:Q0ID79"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR016377"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ID79"
FT                   /protein_id="ABI45857.1"
FT                   /translation="MRQQFAELCSIPDALGKGTVSKLLMAHKWLPSLLTELYEHHSSED
FT                   LNLLSSQLLHSERSASEKAVSESLDVGSADATATGARWDSSSCVLIAYADTVSADDQPG
FT                   LRCLQALLHEHFNGLSSVVHVLPFLRSTSDGGFAVASHEEIEQRFGDWNDLAALAEGRQ
FT                   LMADLVLNHISASHPWVRAFLKGEQPGARCVLAAAPNPCWDNVVRPRSSALFTTLATDR
FT                   GPETVWTTFGPDQVDVNWREPEVLLGFTRLLDLFCSYGVQWLRLDAVGFVWKEPLSDCI
FT                   HQPQAHRLVEVLRLLLESRCPQGVVVTETNVPEQENLSYLTTGSEAHLAYNFPLPPLVL
FT                   EACLSRRADLLNNWLARWPQLPQGTGLLNFTACHDGIGLRPLEGLMESDRLLQLLKQCE
FT                   QRGGLVSHRRLADGLEVPYEINISWWSAMAAPGRDPSHHQRARFLLTQLLLLTLPGVPA
FT                   FYLPALLATPNDNARFLLSGHRRDLNRPQFQLDRLERLLVDVESDTPQVVASLQQAMAV
FT                   RRGQAALDPFAPMKVLSEGRSDLVILQRGEGASTLFAIHNFSDVRLSFPLSTLANATGC
FT                   VWHDVLKGHSLVAGQTALDLEPFAVHWLTR"
     MRQQFAELCS IPDALGKGTV SKLLMAHKWL PSLLTELYEH HSSEDLNLLS SQLLHSERSA        60
     SEKAVSESLD VGSADATATG ARWDSSSCVL IAYADTVSAD DQPGLRCLQA LLHEHFNGLS       120
     SVVHVLPFLR STSDGGFAVA SHEEIEQRFG DWNDLAALAE GRQLMADLVL NHISASHPWV       180
     RAFLKGEQPG ARCVLAAAPN PCWDNVVRPR SSALFTTLAT DRGPETVWTT FGPDQVDVNW       240
     REPEVLLGFT RLLDLFCSYG VQWLRLDAVG FVWKEPLSDC IHQPQAHRLV EVLRLLLESR       300
     CPQGVVVTET NVPEQENLSY LTTGSEAHLA YNFPLPPLVL EACLSRRADL LNNWLARWPQ       360
     LPQGTGLLNF TACHDGIGLR PLEGLMESDR LLQLLKQCEQ RGGLVSHRRL ADGLEVPYEI       420
     NISWWSAMAA PGRDPSHHQR ARFLLTQLLL LTLPGVPAFY LPALLATPND NARFLLSGHR       480
     RDLNRPQFQL DRLERLLVDV ESDTPQVVAS LQQAMAVRRG QAALDPFAPM KVLSEGRSDL       540
     VILQRGEGAS TLFAIHNFSD VRLSFPLSTL ANATGCVWHD VLKGHSLVAG QTALDLEPFA       600
     VHWLTR                                                                  606
//

If you have problems or comments...

PBIL Back to PBIL home page