(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE355

CP000435.PE355       Location/Qualifiers
FT   CDS             366858..367679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0362"
FT                   /product="mannosyl-3-phosphoglycerate phosphatase homolog"
FT                   /EC_number="3.1.3.-"
FT                   /note="identified by match to protein family HMM TIGR01484;
FT                   match to protein family HMM TIGR01486; match to protein
FT                   family HMM TIGR02461"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45573"
FT                   /db_xref="GOA:Q0ID78"
FT                   /db_xref="InterPro:IPR006380"
FT                   /db_xref="InterPro:IPR006381"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ID78"
FT                   /protein_id="ABI45573.1"
FT                   /translation="MVNSMTKTDALCSIPWWVVTDLDGTLMDHDYNWEPAREAIRGLQL
FT                   KGIPVIPCTSKTAVEVKHFRAAVGLKDPYIVENGGAIHGETSDGEPWELVLGCPVAELR
FT                   PVLLELEQLLSEPLQPIDALSDQEAFDLLGLQGKALQLACTRCWSLPFVPPSASARQRL
FT                   PDLANRLGFAVVQGNRMGHLLGVDVSKGRALEVLKQRRAGSPVRVLALGDSPNDQPLLD
FT                   AGDLSVVVPGANGPHPVFAEAIAQGRYQLASACHAQGWAEAVFQYILNEQS"
     MVNSMTKTDA LCSIPWWVVT DLDGTLMDHD YNWEPAREAI RGLQLKGIPV IPCTSKTAVE        60
     VKHFRAAVGL KDPYIVENGG AIHGETSDGE PWELVLGCPV AELRPVLLEL EQLLSEPLQP       120
     IDALSDQEAF DLLGLQGKAL QLACTRCWSL PFVPPSASAR QRLPDLANRL GFAVVQGNRM       180
     GHLLGVDVSK GRALEVLKQR RAGSPVRVLA LGDSPNDQPL LDAGDLSVVV PGANGPHPVF       240
     AEAIAQGRYQ LASACHAQGW AEAVFQYILN EQS                                    273
//

If you have problems or comments...

PBIL Back to PBIL home page