(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE356

CP000435.PE356       Location/Qualifiers
FT   CDS             367769..368191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0363"
FT                   /product="Predicted redox protein"
FT                   /note="identified by match to protein family HMM PF02566"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45825"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ID77"
FT                   /protein_id="ABI45825.1"
FT                   /translation="MTAIQCRYTGDLHCTAQHGPSGSVLNTDAPTDHDGLGESFSPTDL
FT                   LATALGTCILTIMGLAARRRGWDLVDASVIVEKTMTTEGPRRIESLQAQISLPVALSQE
FT                   QKTLLKRVANDCPVKRNLDTSITIDLIWNDASSTAL"
     MTAIQCRYTG DLHCTAQHGP SGSVLNTDAP TDHDGLGESF SPTDLLATAL GTCILTIMGL        60
     AARRRGWDLV DASVIVEKTM TTEGPRRIES LQAQISLPVA LSQEQKTLLK RVANDCPVKR       120
     NLDTSITIDL IWNDASSTAL                                                   140
//

If you have problems or comments...

PBIL Back to PBIL home page