(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE357

CP000435.PE357       Location/Qualifiers
FT   CDS             complement(368452..369906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0364"
FT                   /product="PyrF/pyrE bifunctional enzyme"
FT                   /EC_number="4.1.1.23"
FT                   /EC_number="2.4.2.10"
FT                   /note="identified by match to protein family HMM PF00156;
FT                   match to protein family HMM TIGR00336"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45025"
FT                   /db_xref="GOA:Q0ID76"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR001754"
FT                   /db_xref="InterPro:IPR004467"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ID76"
FT                   /protein_id="ABI45025.1"
FT                   /translation="MLRSWADLRGLNGRSLLSQARSWCKSVIEETADHVCAYKPSLGFY
FT                   QAMGSAGVELLLEVRELLPPDLPLIIDIKHGDLNSSSAIAAYLFQSLHADAVTLNPFAG
FT                   QDIAAPFLLYPGKGVFINCHSSNPAAHDLQHHPNDHNPFYLKVVRESQSWGTPEQLLLE
FT                   VGTSDPAILADVRQAAPERFVMLRSLWGEEGNLQCLLKNGLNKMGDGLLIPLPQNLLNG
FT                   NNINEQTSTLKGRINRIRDQHLQERAHTDAIHPEQCRIWPHSDQSNQDDSITTVREDGV
FT                   KPIDQDLWDLVIDLYDIRCLLFGEFKQASGEIFNYYIDLRQIISDPALFHRVLDCYAQV
FT                   LRPLRFDRIAGIPYGSLPTATGLSLQLHKPLIYPRKEVKAHGTRRMVEGEFKKGETVAV
FT                   VDDILITGGSVMEGISKLESSGLNVRDVVVFLDHGGIHDLRAKQRLQSHGVKLQAVLTL
FT                   DTISHVLETSDRISPDQAQELRHTEK"
     MLRSWADLRG LNGRSLLSQA RSWCKSVIEE TADHVCAYKP SLGFYQAMGS AGVELLLEVR        60
     ELLPPDLPLI IDIKHGDLNS SSAIAAYLFQ SLHADAVTLN PFAGQDIAAP FLLYPGKGVF       120
     INCHSSNPAA HDLQHHPNDH NPFYLKVVRE SQSWGTPEQL LLEVGTSDPA ILADVRQAAP       180
     ERFVMLRSLW GEEGNLQCLL KNGLNKMGDG LLIPLPQNLL NGNNINEQTS TLKGRINRIR       240
     DQHLQERAHT DAIHPEQCRI WPHSDQSNQD DSITTVREDG VKPIDQDLWD LVIDLYDIRC       300
     LLFGEFKQAS GEIFNYYIDL RQIISDPALF HRVLDCYAQV LRPLRFDRIA GIPYGSLPTA       360
     TGLSLQLHKP LIYPRKEVKA HGTRRMVEGE FKKGETVAVV DDILITGGSV MEGISKLESS       420
     GLNVRDVVVF LDHGGIHDLR AKQRLQSHGV KLQAVLTLDT ISHVLETSDR ISPDQAQELR       480
     HTEK                                                                    484
//

If you have problems or comments...

PBIL Back to PBIL home page