(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE362

CP000435.PE362       Location/Qualifiers
FT   CDS             373103..374707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0369"
FT                   /product="radical SAM domain protein"
FT                   /note="identified by match to protein family HMM PF04055"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45492"
FT                   /db_xref="GOA:Q0ID71"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034466"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ID71"
FT                   /protein_id="ABI45492.1"
FT                   /translation="MSNAVSIKGSRAAGERVLFVRLPCNPIFPIGPIYLADHLHKCFPD
FT                   LPQRILDLAALPVLDVEGVLLNVVDQFRPTLLVFSWRDIQIYAPVDGRGGNPLQNSFEV
FT                   FYARNPLKRVKGALGGLRLMTSHYGELHRNQKLVRHGLKRARRHSPEARAVLGGGAVSV
FT                   FYEQLGRSLPKGTIISIGEGEPLLEKLLAQQPLDGERCFVVGEAPRPGLIHEQPESRPK
FT                   TACDYNYISSIWPQLDWYLEGGDFYVGVQTKRGCPHNCCYCVYTVVEGKQVRVNPVQEV
FT                   VAEMRQLYDRGVRGFWFTDAQFIPARKYIEDAKELLRAIKAEGLTGIRWAAYIRADNLD
FT                   PELAQLMVETGMSYFEIGITSGSQELVRKMRMGYNLRTVLDSCRMLAEAGFHDHVSVNY
FT                   SFNVIDERPETIRQTVAYHRELEAIFGEDRVEPAIFFIGLQPHTHLEQYGFDQGLIKPG
FT                   YNPMSMMPWTARKLLWNPEPMGSTFGRVCLEAFDRDPGRFGKTVMELLERDYGVAPLDQ
FT                   ALRAPVQGRAALAKAVS"
     MSNAVSIKGS RAAGERVLFV RLPCNPIFPI GPIYLADHLH KCFPDLPQRI LDLAALPVLD        60
     VEGVLLNVVD QFRPTLLVFS WRDIQIYAPV DGRGGNPLQN SFEVFYARNP LKRVKGALGG       120
     LRLMTSHYGE LHRNQKLVRH GLKRARRHSP EARAVLGGGA VSVFYEQLGR SLPKGTIISI       180
     GEGEPLLEKL LAQQPLDGER CFVVGEAPRP GLIHEQPESR PKTACDYNYI SSIWPQLDWY       240
     LEGGDFYVGV QTKRGCPHNC CYCVYTVVEG KQVRVNPVQE VVAEMRQLYD RGVRGFWFTD       300
     AQFIPARKYI EDAKELLRAI KAEGLTGIRW AAYIRADNLD PELAQLMVET GMSYFEIGIT       360
     SGSQELVRKM RMGYNLRTVL DSCRMLAEAG FHDHVSVNYS FNVIDERPET IRQTVAYHRE       420
     LEAIFGEDRV EPAIFFIGLQ PHTHLEQYGF DQGLIKPGYN PMSMMPWTAR KLLWNPEPMG       480
     STFGRVCLEA FDRDPGRFGK TVMELLERDY GVAPLDQALR APVQGRAALA KAVS             534
//

If you have problems or comments...

PBIL Back to PBIL home page