(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE363

CP000435.PE363       Location/Qualifiers
FT   CDS             complement(374671..375501)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0370"
FT                   /product="CAAX amino terminal protease family protein"
FT                   /note="identified by match to protein family HMM PF02517"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46301"
FT                   /db_xref="GOA:Q0ID70"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ID70"
FT                   /protein_id="ABI46301.1"
FT                   /translation="MRTSWFTLKPRWIPTITLIPALYALGWLLLQPISLLVPGRSIPSQ
FT                   DLIGTGISVLLFLLILPSWTRTRWETRHPWRQLGLKAAARGPSSRRSLLNGLGWAASLL
FT                   LIICLISLGGQWGQWLGDFSAAKLINALLLCFGVGLIEELLFRGWLLGELNLLIGAKRA
FT                   VPAQAVIFSLVHTRFNLGFWPMLSLLIGLFLLGMALATRRQLDGGSLWGCIGLHGGLVG
FT                   GWFALQSGLIQWSPESPFWLTGPGDNPLGGMVGIACFAALLSFQLTALAKAARP"
     MRTSWFTLKP RWIPTITLIP ALYALGWLLL QPISLLVPGR SIPSQDLIGT GISVLLFLLI        60
     LPSWTRTRWE TRHPWRQLGL KAAARGPSSR RSLLNGLGWA ASLLLIICLI SLGGQWGQWL       120
     GDFSAAKLIN ALLLCFGVGL IEELLFRGWL LGELNLLIGA KRAVPAQAVI FSLVHTRFNL       180
     GFWPMLSLLI GLFLLGMALA TRRQLDGGSL WGCIGLHGGL VGGWFALQSG LIQWSPESPF       240
     WLTGPGDNPL GGMVGIACFA ALLSFQLTAL AKAARP                                 276
//

If you have problems or comments...

PBIL Back to PBIL home page